ELF(44 (pkk444,,,,,P%4888((( /lib/ld-linux.so.3GNUwAr7 PNh2vUO]8@1X)D~SnoJ'Vs.b3;K^yjci0?\,%B_&<e/ d fxL5}C :|GpFWMI>zT!mtl(*E[{ R6Qq9Hk+4"$aY=-u#g`Zd  $PQ0<T*HHT/`ldx,4%Z̚>  ?ؚ;~z8h d,8Dd P#\@hxt-<Px)dwț}ԛT1`L|8"dbdm(g4@ LdXfdpm|{`0VĜ4Мܜ<s6< TL$0<<IHltT,_`ulLx<t{dZx̝|؝Th<Tt0@E `t,<8bD5SPl\2hht(3Xnd8[JHȞԞIds|A@0aP(4,Q@LlXL8dH?pD|x+((P;Bğ@BП4ܟ  S0m @libnsl.so.1__gmon_start___Jv_RegisterClasseslibgcc_s.so.1__aeabi_unwind_cpp_pr0libc.so.6chrootsocketfflushstrcpyflockfileexitreaddirsprintfsrandfopenstrncmpinet_atonstrrchrconnectin6addr_anyclosedirstrncpysigprocmasksigfillsetunlinkputcharlistenselectmkdirrewinddirfsyncabortstdinmemchrtolowergetpidkillgetc_unlockedstrftimeinet_ptonchmod__assert_failgmtimestrtolfeofsyslogtruncatefgetcfgetsgetppidstrlensigemptysetopenloggetaddrinfomemset__errno_locationbindtcsetattrfseekchdirmemcmptouppergetsockoptclearerrvsnprintfsigaddsetcatopenstdoutfputcrecvfputsmemcpyfclosestrtoulsetsockoptmallocstrcatstrcasecmpraiseremoveopendir__ctype_b_locsscanfrecvfromcatclosegetservbynamestderrstrncasecmpif_nametoindex__fxstatsendmsgfilenousleeputimeschown__cmsg_nxthdrgetcwdfwritefreadgettimeofdaysigactionrenamecatgetslocaltimestrchrfunlockfilegetsocknamesendtofdopenqsortaccepttcgetattr__ctype_toupper_loc__ctype_tolower_locfreeaddrinfofcntlgetprotobyname__xstatunamememmovestrsepstrcmprecvmsgstrerror__libc_start_mainferrorvfprintffreeGCC_3.5GLIBC_2.40 U&y Uii D6akp<@DHLPTX\ ` d h l ptx| !"#$%&'()*+,-./01234578 9:;<= >$?(@,A0B4C8D<E@FDGHHLIPJTKXL\M`NdOhPlQpRtSxT|UVWXYZ[\]^_`bcdefghijlmnoqrstuvwxyz{ |}~ $(,048<@-MЍ/-4RƏ%ʌ4Ə%ʌ,Ə%ʌ$Ə%ʌƏ%ʌƏ%ʌ Ə%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌ|Ə%ʌtƏ%ʌlƏ%ʌdƏ%ʌ\Ə%ʌTƏ%ʌLƏ%ʌDƏ%ʌ<Ə%ʌ4Ə%ʌ,Ə%ʌ$Ə%ʌƏ%ʌƏ%ʌ Ə%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌƏ%ʌ|Ə%ʌtƏ%ʌlƏ%ʌdƏ%ʌ\Ə%ʌTƏ%ʌLƏ%ʌDƏ%ʌ<Ə%ʌ4Ə%ʌ,Ə%ʌ$Ə%ʌƏ%ʌƏ%ʌ Ə%ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌ|Ə$ʌtƏ$ʌlƏ$ʌdƏ$ʌ\Ə$ʌTƏ$ʌLƏ$ʌDƏ$ʌ<Ə$ʌ4Ə$ʌ,Ə$ʌ$Ə$ʌƏ$ʌƏ$ʌ Ə$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌƏ$ʌ|Ə$ʌtƏ$ʌlƏ$ʌdƏ$ʌ\Ə$ʌTƏ$ʌLƏ$ʌDƏ$ʌ<Ə$ʌ4Ə$ʌ,$  --0-D-0 0S/D/K 0S00/-(M0 S R/Ѝ/4//A-x1M@p d ?  DXI HPT `W@N@ 1T!P00\ @  R0\  |@ 0  @$/R>DT 7ЍA/|tT8X@-M@n^P0 0Ѝ@/h@-M@YG\P `KaP`@` PE 80.Pp+/Π +(+xh+0,0 |  0 ,<4X@DHLP0 ST̈́ -̈́-p0Q M@pT ̈́@ ̈́$̈́̈́Ѝۍ@/tTht4 @-!Q@p@@M@@@@p`PGT+ | HH1`F p -Q0S@ Tp@p?@`FPV\0S  0ǟh0p030pGldh Rs= ؝Ѝ@/$ \A-4"M0S  B"2fpP h Bnf (@ဝT@W Pp%|@PP wP!`p`3U`V @xP hP :AP`Vl,4P&  P PP P P Pd|P0T ?b ^ [|QzЍA/+     L T \ ` h 0@-MM[P @j @D+TUt +<MU\lTpLtDx< |4 rЍۍ0@/        p@-0)QM00`K  :Ѝp@/`P :P@D ᣽0P, S{:( $ 8 E-BMMK@!T X 갲Ȳ ,PppR WPB." -4$P=X `B+T +a+Y{+Tp\6 h ]0`@S @D PU ,P P p$ЍۍE/L \ l |      O-EM M!B  G,Ppp^ W\E^ " ,T4$PH@<ˍ3+S  S&Z` T+6T  5 Ƽ $@+TT6TTB  B \&@B. T PU ,P P p\ЍۍO/  8   @-MMP @`p? ❊<|x1@Tl0  0 0 0Q 0@C +S R0p!x$  0Q  0+ pd 0S h 0 0DЍۍ@/  (  8 H h    p@-``T`4PM MP  ㌳Op r' t`V  LX ^  3c/pLp Rt00 HX0P  3ß/tH`t`p` r' Q  T |0R DT P3@ß/T^00 P|`Q  3Ÿ/0P0 X4|4`V00  P  2Ÿ/Q00 =S Lh h2HŸ/ -@B"82$`@TmM-hV88  ^  1/ (R88 =S  1/ xAH!1_@TQ D,R> MT== `\ $ 1/ ^ = = `Q  0/ - 0 ==P\ =_PUPfxYЍp@/&  )4 \ .  /5  6?  , 0@-M-$R44 0S  0/Q44 P^ `` h0\/$ 0LP44 80Z_$P@TЍ0@/<=@-d@\R" P000"00" Pd00d0 @/- M0_ Ѝ/m- MZ?cЍ/-@-PM0H@S @N  Ѝ@Ѝ/p@-P|m1 h(@`R88  =S @@ <1</ Q88 ^  0/(-0 0^VQ CQ Eͅ$6,R>LQ tL l0]ldPEͅ 4 D0 ^p@/43X4d?`D0@-PPMxQ p0p/dcMT P0S 8@Y@ToЍ0@/ 0@-@PM 2Ÿ/9P=S0= R00  P  2Ÿ/^00 -R HX X2DŸ/0=p R' tQ  L XR  2/p0L0pPt00 HX^  1/t H 0t0p0 r' P  T|^ <d `18/ T P00 P|0Q  1/P P 0/0S b A 0T 0\X&2|$2 P00l `0]Ѝ0@/(@Pl@`@-@l R e0S P0S |0^ tt/h0h P\0HH/HB@/p(0@-PMl*M 0@S L0T  PȔ,M@Ѝ0@/p@- 0@/XU88 `P  0/(R88 l`^ `` d0\/80<@$ ?\@Tp@/[-@-p0Md@dd y  44 R 000S0$$p@-@M`Pؖ  0-@T rt 4 ,\( $0$/Ѝp@/, P0@-`0`` MPT0`@PDH/ +e $$Ѝ0@/\@-@,0Q 4$@/t@-Gll0 S\1\/P!PL14!_@P(<W8 |D x0@S"0 Ѝ0@/26;(LpSO-EGM ME΍$P0StTpT  4t/p: !@pPP P G.pD>"YG΍p 0tDv!P G> p0tDm!P(,P 0 RFEFN,p 0AP`V P \ 0 0st`k 0^ 0MTfENtA^0=P0́ @~@D8W+IFg   R.sPPp00`SY0,`,0`,0E- ,PQF`0` L<@ < +< p`D`A`4 -@Rh mEH mQtf`V [!@TJ WY  ,\ 0S  SZP `>MF\jhhM@h Arh$(R88  ͗\  1/8 =P88 -R  0/U088HXPX`FPV P X ͗ -( ] |ЍۍO/l) S,O-PqM MT T P=P͟/D 0S $ 4 0= M/ - ,.;_XQ \ ``}W ў Ϟ  .@2E^ ; ", **,*X^p0.R 0RL< Q@Pp,l$-`p \ $Q \\$$Q^ <p  C.  ;$Mm΍ P `)k* 0KJPP 2* /*$MFm H ,P 0Q Bp@m. P` )* -0JPU  * *mp k )2 1,pW 0^ \ʟYBpP`m @ )Q*: 0I@T  )m A+ k)lp 4 pB +G i ;P0  9,ɟ/qh QmPMP9,^ pW 0 RQ Π0S S @<0 `V ] $pW - (^ M`00  w ,PU 0P T(ppN BȠ\R040 40S 008~`P@| qG~, (^ $('^ (`Vx ]Pl8 ̖ЖԖؖ0f~,@6<`V v: s:NsA @oA+(q ,0 @\ ~+ #,g7@@ǝ帀ᰀ崐' gGP U 7@\@'g T  ,xv  : !A $@ ǝ(@ (0S $ gW(  ǝ  ( \%XEPB`V @ -0H,E|$%VP  |4 ` 3M5@$(  .($\hQT~m㲐tğX|P@h`lp ,  +  * J+ r7)VgHᴀǝP'@'090W fNl '**0`W0pp0 0W0ǝ 0R ``W0'ǝ J  - /  / x0 ] Q0`40`TAV@P||"=  p< `d!0"$08P0 00 0000(0,04000``H0L0P0T0!UP X!>'| :' 6'3Z0``0-R@mM`MXUH1H ` P ,!Q 1 P ߍۍO/Th|4hXhtrt d<Ph|4 6  \00@-@M`80SG,QQ   1/A R 3 ^== 0S  0/- P MT = =@Q t 0p/0 D@ - -Ѝ0@Ѝ0@/T(W ^d@-M|@ ,tt tl R" uTL<H @0@S"0fЍ@/  @-t0@ Qd0ddd/TMT @@NP ,@@V@/(@-P, M0pS  2Ÿ/`VAQ0C R 1/`@8 Ѝ@@|`''t!!(0W0@@0D@ TZ?0DZ@@0ADT@0T0`T AP` 0T`0PP D\?VdPd * @0Pݶ| |' Ѝ@/ ` H\0 ,XA-PM  3R  3ß/P  3C/S#x `V"`s`0 `C^P(\ X3$ß/D@|T 4 03r/Q00 H^  2Ÿ/0H0 R00 DP p 2lr/Dppp,0S *@Jd"d "\0tS) @? z,^h $B$`2 0B0q\ 1/ w*L!C^'`P i*t!6X@$ $HP \ X1/Ltp^@LH@pptp  L@."0 Hߵ 0 0 .*8 H 00CS"0PЍA/^ l_ e j m n (Lu `  D<Hh @- MuPp!`]8 -0S Aw@>wT 8[@PvTh Ѝ@^ HH D1DA/8@w0 "! 0SwP0S Bw*wڱ P 0V R 0QpnP P Ѝ@/ `, `( p@-@PL H0HH/<E40P0  @X @ < O-P0IMS Q hh d?dϟ/XX!TT/4HY"8O0`( F Q ?Ο/ ` 0 pP  >刞/ XD R  T >PΟ/t^p00 H P ` \>Ο/p0H0pQt00 D R  >͟/tD0t0p04P PQ R ͟@T ,f  (T -,P' Ph @lfXMT BD 0A0P $ =̟/ ()t,4@T/L܀  xP'uPvu]xPvP vP vU P ? @w? w 0 PPG/E/$@P=P3 4Q# T\ $ R  ̍ 1 ^$ 0P$0 (.| h+JT-\P !P@  0  U" " +P"L +\L HptLD0 H咳Y< 0' *ZF/堊3G0S& JP E-$ !h7%X2'H-D < 0R0!h00h0 d0S  .P o,P* ie l" @ U @ P TP:U yFW2 }'6 D<)!  \4^ 5V4 F$=$=42 Z'g` (@TT\ 8^4 2Q/ -@R0=T `$4P :w͗\^ <0Sȟ R8 ,F1 'd'Dp@T% 0=P d렗@@@!7 Q dE$%ƟE$  U0 @ ` 0S+ (^%ǟ(mq <S Q4PUP(P.qQQ@ 㡷 0 $ R ( P^B $͗\\0S< @T 0 4ğ/p R $MT \0S yş\@$DT` Rl$M4@TP  4L  F,PU ^+ %@<<@H 0S  ş0 R. PT@@ 0T P@"0@T > @p@30P @\L  R$ ( V F0 &\.@TDЀPN00004 0 @`1dAPw.$PbP]4@4G R=SZ =RS , ?S=@ s*|@\0 S (@8 8͒\#::>^4 Q (\* 8l  ,@,P" (^@~0S00 ( tS PUHP D \L4 FA0 " H  \ T  l h     !`  4!h!p!x!!N !"4"<Hf hdX"t""P`h"?"##$# ,# P#t##d# ###$j$ $r0$D$)T$l$$$ $,%X%p%%$%D%$ Q $-RL  G 0S0 P 0@ F/{1SF/ $  @R" 0IߍO/A-PM  3R  2Ÿ/P  2B/R"`V"` @`XT 2PŸ/,P \\Bk$ 0BS08 42/ Y i$@ w!XPN )bpF? s,P 8Pp@b 0|ANPx X1/`!0<S 00 -$P P- @T  2'/ @\"G $@ 0 CR" lPЍA/ % %  %% ` %& ( - 0@- M 1R  1/A!0^"*P0@]#P d 1`/U =S P T4^-($!+,Q40SA,̈́s n,  @,-m60G>+^ 00t8 P< @R" Ѝ0@/! <&`&% * t&4 &&&N 0@-pM(뵖P`1  T!P00 0S00QI (Q AGT0 Wz zT|@vq 9k@0 0MaNDB tp R(Ѝ0@/'$'L'\'p''''''''G-xxMpEp5d%d5qPXPPPD<4@P % `P ğ0`Q P4$VP $D0`SPdT|$|`Dl6_DddPUD4 R 8 P,(ğP  Px@T*ȃp< `P0S S  @ .0J ((0\xß 8( P `d0XLS`VU x@$4 0 P @_ 09tY@\ `hpx2 2 2 222st 2" pŸ0t $6Pn _4 <Wt\f t⏽c r R_ +0  P, -& @$Q!1&K`P! P@ P0t  \@Y<P 1Q 0  P7P J_  t4 0rG -xЍG/(,ľ(,(@(0T(l(|((((((  $(() 8)$ L)z\}0@-P0lQ@ M ʍЍ0@/@-`M.P@pP  P 0H Pd \ 0Ѝ@ Ѝ@/&O-M P@`  !P pᬐ, - 6X@@ )- & @P 9p2 pS㑏 Db P@@  @P 0 @ߍO/\)0@-PM@0P 0S Ѝ0@//@-@  40/` Xp`@p W@@@`0763d45A/+,0@-@QMP``  0SLD D04,/PP%Ѝ0@/8++L+,O-PM@000& Q$ -60S & PPPn AO ,pe P P$8`dQ P,  RI P P  PpBO PdP PdPfP8@0S P ,Q P P  Pp2h  P BP7 ,@T P P  PpPP8`@T a 40/pP@T T 40/pWP-PkPPC8`@T 4 40/PpP@T & 40/ pWP ,C@\ P0S P Pt T* , * @R" xP@ ,@T8`x 4 \u @/PP0043C : PcUp 1P \@ +t4#y Y4 ,0S dvP4 ,PQ8`2 @0gP053 `P073  .P  $@TP6u U ,P\ }p  { 3P R ߍO/+=`+,x+A|++ 5++++O-PTM# 8`d0SP/2P P @" .0 "P ~PdUpnPhP P @ .0P p Hc P@Z@T  W0S S!P@ DP@ U N43 S!SE pڠ⺐7P P @  .0PA 80@P #q -7P P P @  .0P @@@p4[ 53Sm6#Rt7P `bTЍO/+y+,++ ,,T4,+P,`,t,E-PP Mi 12 @`0p k 0T @XTxT@ R 00  P8 DRPL.@0NP R 00   V6 @ ‚.T\W`6*F@T R/0 + ^)  b0S S S\05̌1:\*0<\8  4Z8 , #4$,< ,00 ЍE/-(-8-G-0MP`p0P  !hPVPU` .TV\` U @8TU  ЍG/H-O-PMP Pr r  V0 @:S:Pf`p 41PP|1x*P d1X"O:TXZIp QB)t@pp` .T6` V2xP-0c @TX  R")Ġ`Z j 00LQ BV  I a  ЍO/h-T-@-$M`P0p@H P`P:00=$Ѝ@/-G-PPM P 0 a`FBoAoAPp`B @Pf1#Q p` 00ATr r v Qp` Pr v Qp`v W`@Pv UUU:00!U : U VW WD ^ Pd A qP! @ 00!h@PUv PU2PPPP a RQ FaPЍG/|-p@-`PM 1/PU 0R  0@/P  0/Q tM 0l@/^00<\\ X0@@0.0i?@Ѝp@/--dAyB2-30.P.7l.9@-@P 0R  0/PT`` _1S0P1 LR (( O@/dAyB--!.).A-hM  1@R`  1/V Q  1/^  1|/ , R1, KdqP@P4(K f@P0!,'OBPP- e$ ,@NT4 R P0PP4 14Pf9@PPTp T@1,@ @@, 80>~N@ zywlhЍA/-/dAyB-0//@-41 MRP  1/ p0@1 `V00 4P  0/4^ 0 0 00S  0/ 0 +@, <0@X>@T 0N> Ѝ@/-H/p//@-@PMPp^ 1/0S 0  P P S)0^ #b.@L`L@L@LD0\@ttP@ `@ 0.2Ѝ@/-//0//O-,M !0TA`P@q ܑ8!0JAP@_ 8@@!@@@! T0Q0X衖q`y P Q p$1 (P,!0@14@AVl@82# e[#  X@PA@P@0  `@PA\0`P00Tdd (  ! kFϠ.0p=,ЍO/-8CAdAyBl.p@-@P`P1 x0x/UX2 X0P/0H 0@S  $?PRp@/$000D0XTCC0@-@PPML H0U < ^ 4/ 00Ѝ0@/$0X0XTCC@-@P]8 40 , ^ $/@/$0X0XTCC0@-@PPMP L0c @ ^ 8/U 0 0Ѝ0@/$0X0XTCC@-@Pm< 80 0 ^ (/@/$0X0XTCC@-@Pt4 00 ( ^ /@/$0X0XTCCp@-@PP``0`G X/0 S<@ <00ࠁ/,P `p@/0$00XTCD@-@PJ8 40 , ^ $/00@/$01XTCD0@-@PMP X0R P H0H/ 0SP 03:S00Ѝ0@/XTCD$01@-@P88 40 , ^ $/@/B$01XTCD@-@P88 40 , ^ $/@/J$01XTCD@-@P88 40 , ^ $/ @/R$01XTCDp@-PPM` 0R  0/@  PhP; 0B0\  ,0 P*@̅ TЍp@/XTCC$0X0 p@-PPM 0R C 0/`@    PD0LࠃP; \`?V@Ѝp@/XTCC$0X0O-P\M` 42R , $2$Ÿ/ 2Ÿ/[ 1/?Qe X 1Q/ p ( ,0 4 8 < @ D HLP T      $ %,@0 $"?@ @  0, 0  0  1 "P@TWPgU P PPP   0$@@pG\ЍO/XTCC$0X0111nSNDO-@PP Ϡ0 f` 0 `0? 0!  `pG`PE `U 0<ЍO/XTCC$0X02nSNDp@-`PM\\ X1X/PU <1R 0 ,1A/P y 1/Q  0@/^  0/OPdOP^0S00<{d l` @@ /0F:@Ѝp@/P2\2koolt22343P3@-@P 0R  0/P :1S \! ^L\ X0H/.AP,, @/koolP2t23330@-,1 MR@ Z 1/0 PP #&P0,'0, 0904P 4< 0948P 8d0< 9080@ R<@<P<< 09 Ѝ0@/P2/osw}G-FMM7-p,W tQ l d7dG/`PUP<@',Q^L⫯ -(   P  6V/ᎏP  6f/!@0S <PP \6HƟ/!@<<Q< Q.R<` @@0\ ` @PHP`Y!@0S <P 5ş/!@<<Q<^ HY X5@E/D5a@^  P0 @@@p 0 `PPPHP0`+, @\  4D/,0D^ l 4d/ATl4V PVe V,$n0"<P`J 7  &`POP <#z0 <P K k_P@ <x#0;P @9Y!048@%, 3@@s8Z P s < 2e8,P 8P< ,0<Q 쁗@ <_i`P @[ P u_`2V %`<Fn F.0l"P , (2/_=`Pe-@=} J_`2VV8@N,P  0 d #0 p&`GV:PO0PO*P, R <Q<8,80S88 @HX aVZ!`U !y,`{pezM0CQ L|  `P`#P: 6hЍۍG/5koolP2t23484l44 a44!53O-M 0!1;pP@d @01L@DH0!P@N l10 졗@,y0@QD4@P8@a <@!`@@Af@< !  8$@Pz AzAAAAP pP00Tdd Y  e@/0-7ЍO/P2UkoolP3p@-0 PR`H 0@/TI 0 ^ x/`^J `0P/,4 ^L 80$/p@L(5P2t2koolL5d5P 0S C, /@-@(T$ 0 /@/550 QH  00x d0X \ ` l p t /0@-PPPPPQM@h0ihh hh0Phh 0 hh0@ h hi0h0\\PPP^PPQPPPPЍ0@/A-@PTp` 0S tt p0p/(Q !R1ST00P0A/5K5@-PPMp`@ 0/T 0S l p0h/( Q!RT00P0Ѝ@/5b*50@-@PPM hh0h ` ^ X/t04U@ <00ࠁ/tetЍ0@/55@GSMX60@-PP@M tt0t l ^ d/T@P L0@ࠁ/(0!SH0Ѝ0@/55@GSMp60@-P@QM 0 ^ /T`p l0`ࠁ/H <RPP0</H 0SH0Ѝ0@/55@GSMp66p@-`P@P 0R  0/T 0/U P Th d0P/AH R(DD0(/Hp@/@GSM55p666A-`P@p 1/h0S ht p1d/T@T P1</W4 01/X 1/ R00 Q,Q  0/0,0P 0 0 Q( R ` 0\/ (0 00,1Q @, (@ ,@A/567*7H7t77p@-PP@` 0/h0S  0/Tt 0p/VLh d0H/,\ @,0 (@0 ,@p@/5 6 7 * p6@-`PM@pH @1@/h0S   1/T 0/W 0/ R00 Q,Q  0|/0,0P 0 0 Q( R 8X X00/ (0 00Ѝ@/56 7 * p6 770@-@PPM 0 ^ /U`p l0 \P/P  00 Ѝ0@/55d @GSMe 80@-@PPM 0 ^ /U`p l0 \P/P  00 Ѝ0@/55w @GSMx 8@-@P88 40 , ^ $/X@/ 55@GSM0@-PP@M pp0p h ^ `/T \,<<00/00`Ѝ0@/55 @GSM H8@-@P88 40 , ^ $/@/O 55@GSM0@-PPM@ 0R  |0|/T P LX T0H/\Q 0S0000\Ѝ0@/@GSM5 5 H8@-@P88 40 , ^ $/@/ 55@GSM0@-PPM@ 0R  0/T  0/ R Q `t p0\/0S 00Ѝ0@/@GSM5 5+!fuB x8@-@P88 40 , ^ $/@/ 55@GSMp@-@P`P<<0  , ^ $/Q`p@/55@GSM0@-PP@M< 808 0 ^ (/@Ѝ0@/55 @GSM@-@P88 40 , ^ $/@/ 55@GSMPp@- P`X0XXXࠁ/L 0Q@@c+T0: 0p@/85$ P t 1pA/d@\x  ET`PFh  Q @a$ @<8`P  1/d@`T  !T<S`eV`` < R Vd 0`/ @^< P h V`XЍ@/D@GSM5 5 : ;6# :(5 &'H $;70@-M@P 8}0S 7P 000 Ѝ0@/@- 1$M Pp`U R  0@/W 0/V Q  0@/`P@ x@P`  ' 0@P  $Ѝ@/E@GSM5 5 D0 0;0@-PP@M 0 ^ /T 0t ^l/^P@ P0@/@0 *00Ѝ0@/55m @GSMn 8h;q @-X0@S l R lX5PD @0@@/XX 0*X@/;50@-PP@M 0 ^ /T| x0` ^X/P <0 d*00Ѝ0@/55Y @GSMZ 8^ @-@P 1R   1/hP  0/0x0  H ($ 000 R Q^P`P r`&\P k\@@/@GSM5v5w7p@-p0@S` 40p0`PUG P 1/P 1/V Q  1/` `(`L!d1)``P $!@1)`RP[ 1 )00`0 PVQ  0)P\P$ -P 0P/\\X 0)PP\P P% P0~)P\p@/5;;;<  G-!(0`wPq Z00 P  1/@T 0 0 ^ xx |1t/ 00$@  : pW00 (P , (1/(^ 0 0 $0S  0/ $ Ps 0/[` 0(@TP( L0( PU`YG/5@<d<<<<@-@P4MPp`0 /  (;,0 S m@j80WU @ 4Ѝ@/5< @-@0$ b-0P @ @ @/5@-@P P 0P   0 @@/0@-PP@M 0 x ^ p/TL\ X0 ^ </0p30Ѝ0@/55' @GSM( <0@-@MTP'  R00 0S  0/Q00  R  0/00P@ kP \    Ѝ0@sЍ0@/5K$=P=0@-PP@M 0 x ^ p/TL\ X0 ^ </0p30Ѝ0@/55M @GSMN <0@-@MTP'  R00 0S  0/Q00  R  0/00 P P @Q  @@b#Ѝ0@/5*|==0@-PP@M 0 x ^ p/TL\ X0 ^ </0p30Ѝ0@/553 @GSM4 <0@-PP@M0  ^ /Tt0`%  ^ P/H ,*P  . Ѝ0@/55? @GSM<B @-@PM`  1R 1/P  1/VU wP@P; P6 p| `P P+ m n" 0 2# `` 0S   0  |P 00 Q R 0S Ѝ@/@GSM] 55^ ;0@-PP@M0  ^ /Tx0dt  ^ T/8L )P  M Ѝ0@/55 @GSM<  p@-@P`dP U@@Tp@/G-PM@P,`0p帒dd `1`/0S8D @14/T$ 1 /V P  0/UW 0 W Q 0 /(  P| P V00U 0 H0PЍG/5698=50@-@PP M pp0p h ^ `/x0 S t R:t0t Ѝ0@/55@GSM0@-@PMP $1R  1/hP  0/d0s  0/U" ^ R | 0x/D YP  0pPP p Ѝ0@/@GSM5 5 7 = =p@-@PP $1R  1/dp  0/U0 S+ pQ jpP#SQ  0`/`h0PU p6PP ^ p Pp@/@GSM5- 5. =8 ,>0@-P1$M@T R  1Q/)Q  0P/h0^  0/dp  0P/ )PP l  lPP00l0X0 $Ѝ0@/(E@GSM5 5 h> 7 =0@-@PMP 1R x p1p/  LT P1D/h C QQU 9hha >P ,0,<QptP0p0PU ih0 0i0Ph$Ѝ0@/@GSM55 >p@-PPM`@ 1R  0/T 0/xP  0/hQ t 0p/|`1  Rt0R: x@Ѝp@/@GSM55+>7A-@PMP X1R PP L1L/U(4 01$a/ v P 1p/ Qp`^ 0S$\ 0/ 5 ("fc`]ZЍA/@GSM558>>O-PPdM  |5R tt p5pş/x RLXX5Le/[(< 85$u/዁([ 0(004(  ( 4`(`4xt `0b0t,Q 00p, ,00`V_ $X\ TpWWx@8q0` 0",0YD 0  0| Pp\ 0 0| \p x0t 0 W000 Y: @ <3C/ .|x@8D0 pXxt  000p ` `$` p$p0#[Q \1S S.S 0S004 R00(Sbx@8p` ",Y0D 00 0| d\0Pp 00 | 0z\ pxt 0 W Y:( 1@/ !|xx@8D0 0xt 0000qW  KR0 0Ó0$`Vt Xm(0S(\xpt  0(p 00dЍO/@GSM55L?h?_?0@-PPd@0@[ ` `L\"0H@S@TP <P  @ `@0  40`@@PPD <QP>#"P``@ P\ 4\@\ 尐\08\ \``\`P  #S$(` D\0`(@\00 $0`(``` ` @`0(0``` 80Q ` @Q5\`\@0\p p\ )X0\pX@T``@X`.ἰ0!20@`D0S \ R`\0@`@` X ` R``0``` `@ R [0P!<uV `4!P1n`[ 4 010A/V  1/,0,0, A P:@0S@# @`@`[ 0p 0=V `T 06@dh@@@`X@@lЍO/5x?@ @?O-pPlM  h6R `` \6\Ɵ/X8D @64f/hP  6Ɵ/ `h0!hh`h`\ L`0 S`]~{%E@qnk hhD`0 $h0H@ (@@/!@P! P oT X` D0`Pxd P Q `Vi 00P @@ @#4jdd`TX@TXd `r d  Q 0S   0 P \ @P 4X# PP  ` 崠 2`P @(0S P($P @(P```Ps:@T` b`|"2 ` dG 2`Ÿ/@"t2 @VQPRP2VP V{PhD `h`0\P  R`;VP VdD 0IPQ`(1PP PQ`D 0`6P  R`\ PP P>\&`^` ,,a(!(0@@.` /, 0T!P` $宵i i VPU``  P{ r`d` @`x@`vlЍO/@GSM5"5#<$ ;%OxD@q?l@ |0- M 0 Ѝ/5@-PM`9& R00 0S  6Ɵ/Q00 pW || 6xƟ/   @T&P00 0S ( $6v/\00 ^  5u/ @T@T @ 5|ş/V4  0 0.@T00 ^ @ <5u/  \00 0S  4t/   0  @ R@pvp3T00S00 @+ `V00 Q ,X T4(ğ/ R 0 0 P  4ß/ 00  @T@T^00 @+ `V00  R P 3Lß/Q 0 0 0S @ @3ß/   @T@TP00 @+ `V00 Q t 2pŸ/00^ 0 0  R ,p p2(Ÿ/   @T0S F @Q h Ϡ1<@@@Q i  d1-0 0.@T00 \ h d1/  ^00 Q  1/ 00 0 @ RW?uP T 0P/iP $ 0 /Ѝ@/5.|==3$=P=5?@@K@A[(APAgxAAAAB0Bp@-PPM` 0/ ^0x x@^ d/@`  <0`0A/0Ѝp@/\B5#pB@GSM-0@-@PPM ||0| t ^ l/0ESDT P0Dࠁ/h0 h Ѝ0@/55@GSMBA-`PMPp   3ß/W 3B/0S  2Ÿ/EP 2B/Ax"2@P h0 h g 0Q(0,0 0`000000000000000( P)P < PP{D P!,P R 0 0  | @C R - ^00 Q  1/ 0 ^00 Q  0/  008\ R 1A/0ЍA/5D0\B CB@GSM$C0C@CdC40 ( 0     $ /nSND@-@P\ X0 P ^ H/0 0 000 000 @/@EHEnSND0@-@PPM hh0 \ ^ T/U  \$,0$/PЍ0@/@EHEnSNDE@-@PA< 80 0 ^ (/P@/@EHEnSND@-@P<< 80 0 ^ (/@/@EHEnSND@-`PM 1R  1/ R1/ h||1h/QJ Pp?W0L H1,A/ @!0B]S:@TT*/P?UQ 0/@ Ua0BQAB0 \Q00B S\S0B-R QPU* T:Ѝ@/nSND@E)HE*F+,F5HFp@-`P@ l1R dd `1`/ R<WD1</ ((1/Q7 T@0 0S- *R@)P?U 0/@ Ua0BQAB0 \Q00B S\S0B-R QPU* T:p@/nSND@E[HEF],FqHF@-@P 0 ^ x/ XR``0T/0SQ *R@/@EHEnSNDFA-pP 0R  0/ R0@/@P?Uj 0`/` @?T`ࠁ/T*Q ` 0XP $0:A/nSND@EHEFPF- S1#Q R1^N  \$ 01^N/YT0@-@PPM XX0 L ^ D/ ^ Ѝ0@Ѝ0@/@EHEnSND@-PPM@ d1R \\ X1X/T ,Q $ (1 / 0R  0/ 0R+ p WP@! $`V ?V 0/0 0S@ @ PPpGPWЍ@/nSND@E\FF\GPFYTG-PP@ 1R  1/ R1a/ 1/T dY \t p1X/ R4TT14/0 41a/ `@ Z 1 !"pP?W?U 0/W@ *0 0S@: PH`X Y 8p l04/G/nSND@E\FGGFGG  HYT",H@-@P`` \0 T ^ L/ 0,S4 00$ࠁ/ @/Y@EHEnSND[8H0@-PP@M hh0h ` ^ X/T4 <04/00Ѝ0@/@EHEnSNDxO-p@MPZPࠁ/ p@<?Tj 01 ࠁ/0p W  1ࠁ/T` W 0@U U  0/0T p0@00 Z Tp l0@/ W (L H0/ЍO/@EPF\HLHpHHHE-`PMP 1R  1/U lQ dp l1`q/ 0X8L H14/ pW 1/  0/ R I @  0XWW  Z `0R0 0000Q  XU "ЍE/nSND@EH4IIII@-PPM`p 1R  0/ R0/ V: 0/W 0|/Q   @ 0  0LV00bЍ@/nSND@EiHEjFkJ,JO-PGM` 0 2R  2Ÿ/V \Q T` \2PR/ R,<2,r/0S 2/0  R  1Q/pPU@ rPP@ i 0RA p@A 0)@ P @ ?U?T   1/UQA 0 00S\PL[HpG   R0S0 0 Q00GߍO/nSND@E:\F;FDJ=\JB\G] HYT@-pPS,`FQ4@@@@@=[T 0  >P,\3@@PP  0    0 @TP>\,0PS03@0@0@@`FP#0  VZ $ R\ m$ RjV{ Z x 2tŸ/UUU@T4| x20Ÿ/0 @[0 H 2/(  R= PV(0%`% .*F@?T 1/dPA@, pR1pp0QUp` [x @1A/U@ 0  #!,`,`0PaD\ X0@/@T,xЍO/nSND@EHE!fuBS,R$HMuTYTYU$T8TDTPT@-PPM` 81R 00 ,1,/V 1q/  0/pW pP ,@T@#T@! ቡ  0S0#0Q   P3Ѝ@/nSND@EHExHM0@-PPM@ 0R  0/T Q  0/ 0R P` \0H/ 0R埠p3Ѝ0@/nSND@E\FF\G0@-@PPM LL0L D ^ </ 0 SЍ0@/@EHEnSND0@-@PPM <<0< 4 ^ ,/Ѝ0@@EHEnSNDp@-`M@ zР0PP ֠Ѝp@/0@-PMP| Pp P  P\ PT PH D@0 4 :Ѝ0@/`VtVlV\VdVhVV@-,MP@p`P@  0\  B,Ѝ@/lS0@-PM0  S P@ 0  Ѝ0@/l   t  E-MP]` a0@S񟗂(<h RmmP0  epW  aP\0 YW hUG\NT MPH@ Gᒟ0  N 0q03P0#S 001 R.R((P0   RP0   RpP0   RHP000ЍE/VVHVV3VVA-M@p` 0 * 0 S'P *@TQ  x0x@/@ 8P  V R P0S)08ЍA/VVE- M0 @P00& 8P$0@0Pd |t`pPPdꖟP `\ D  W@@0T0: ЍE/R@-@M 0p`~8PP %0P fP P@TЍ@/@-M0@ P00Ѝ@/@-M0@ P00Ѝ@/@-M$0@ P00Ѝ@/t@-M$0@ P00Ѝ@/@-M$0@ P00Ѝ@/@-@P88 414/0*S N 1/P  0/ R Q( 0/ R 1St 0p/0 Q4\ X00/ !@/X7XX9 Y:(YEXYGlY@-@P 1/0*S  1/P p 1l/ R QL 8UP18/ RB 1P> : 1/Q 0/!0@R 0/!0 0SX 0T/  0 8#(Q!@/XQXRXS Y(Y_YXYaYgY0@-@PMP<< 828Ÿ/0*S  2 Ÿ/P  1/U] 1/ RQ1/!1R\ 1X/!PH R P L1/1!CR$ 1/!00 Q 0/ 00 !0!0P/ 1 000Ѝ0@/XqXrXs Y\u(YvY~XYYY@-@PDD @0@/0  00000 @/ZZ@-@P 0/0hsl h0\/ @L H04/ @/#ZZ%(Z&XZ0@-PP@M 0/T 0/ x 0p/ PO `0H/ 0 PP 0 Ѝ0@/Z|Z678;ZZ@-@PPp`M0 /Ul] p0h/ HT P0@/0 0 p`Ѝ@/ZZrxvXZ0@-PP@M ||0||/T\h d0X/ 8a @00/00Ѝ0@/ZZxXZ)PD/PP9*PP5*P3 /<P/P"P5  P2%&P#'P'.cP -P,P**P +P0P"1PP/fPgPPP#/!P0P//A/@~P@D/ ///@-0@SDD @0@ࠑ/0 ̀ @/ZZ@-0@S00 ,0,ࠑ/ @/ZZ@- @R$$$0$/0@/ZZp@-0M.S P  `@ S <0<<</ #  Ѝp@/,[[!1P*P*'P )P PP*c0@S,P//@ (~R/PP0/S/gPcP *'P )0@S P:PP//0@-P MP@)0 0S0 0 Ѝ0@/A-M`P \0 @00@" 0QD0 @0KT\H z=p 4 C|@ @GTD FDLD p @D@p R2,rP00or@ rer@r @p [r@U r00UQr00ЍA/᱄^ 90@- P0@ %P\PP M    _0S0 @0 Ѝ0@/p@-M@ P`J0U 婚iЍp@/@- QM`p@P o 0/Tp 0/0S q 0/P |r 0t/P P P Ѝ@Ѝ@/@[P<\[|[@- QMP`@p ` 0/Ta 0/0S b 0/P `c h0X/ RQ,d<0(/!Ѝ@X[x<[[[p@-`M@ 0PP Ѝp@/0@-PMP RP &P P P PPl d PX PL D P8 0P$ P P  P |P P tP p/P )&P "P  P `$Px} pz\+Pdv )PXr Po'PeR-P<i 4fNP(b dP^ 1PZ 15W:cPM@fPQ 15N:gPD:PH PD A2P= 15::1P/+41.+(|%t"ld\TLD< 4 ,@0 !ᏙЍ0@/\\\t$XtV,\0\D\<\@\P\T\\p\h\l\|\\\\\\\ ]\\\\\\]\\ ]]T]<]0](]H]D]l]d]\Vt]V(\8\L\d\x\\\\\\]8]L]\]H|]@-,MP@p`P@  0\  0 B,Ѝ@/lSG-M  1` @0SP 1/UU "`PE/ 0B^SUPEI\Go o0 ?o {o0@@ vo p0@;R"R \RUPE'\UPE" 00Zpd*U " n@ @R*D H0@/0d ЍG/Z]]E-PMUp= (`0 S!00wSf B6S! Ss SR S SSw S"Sy S Sh2S 4S 0S\Sz DS :S CS HS PSd ESiS, dS hSqnS pS mSS| Sn S  zSU ~SSE S& SS S SS Sg SzS S S SS S SS S S#S_ S1 S^ U 彗U~ 嶗Uw  ᯗPUn \ 妗P  Uc 4 囗P0N zU  ᐗPUPtUM 兗Pg hUA yP0, XU6  nP  MU+ h cP0 BU @ XP  7U  MP0 U BP  !U 7P$0 U ,P  U x!P 0 U TP#  U0 P 0 U P z U P0 U P d U ߖP0 U `ԖP N U 8ɖP0| U 徖P 8 U{ 峖Ut ᬖP0_ nUi ᡖP   噖P6L xUV h厖P0A mUK @僖P  bU@ xP0+ WU5 mP   eU& ^P0 =U SP  2U lHU  TAU <:P!0 U /P%  U $P&0 U P'  U P)0 U tP* } U LP+0 U (P, g U P-0 U וP. Q U ̕P/0 U P0 ; Ud ᶕP10i xUs 4嫕Pc % Uh ᠕PeU_ 嗕Py{UV ᎕Pg0A PUK 僕P  bU@ |xP0+ WU5 TmP  LU* ,bP0 AU WP  U LP00/U @P  E\ 4P@ Ey  N0 q 3P #RЍE/Vx2]]]]$]]]]]]]]]]]^^ ^^^ ^$^0^4^8^<^D^L^T^X^\^`^h^l^t^x^^^$^^^X^^^^^^L@h%P%^^VPoE-`PMpXX T5Tş/W0< 85,ş/ 0   5ş/Q3 Q! Q ,Q Q(Q! $Q; Q F#Q Q Q !Qi*Q $Q @P@PPB 4ß/0A  b7@PP@P\h T3<ß/0 A 7 /P /P PU@Ⱐ OP 2xŸ/  0N!`'`%@T5PUHH (2b/00C0 sRSR aRAR @Q`S*u 1/P d@P* d1L/PdP0@P*<D 1/P d0 0%V "$PU!@Ⱐ Q x0`/ 0 0C  0 /ЍE/Z6Z7^XZ^]_$_<_9T_l_p@-08M SP@`  0/P&P PP 0@Pr7@PV 8Ѝp@/__@l@-0T< \^* 1/\X f0 X0\ ; @  XP 0 @   0S\ X@`@/PPlЍE/ZMZNTSOXZl_]_@-@Px t0t/0X,S T0L/ P $ \0  @/bc(c@-@P|| x0x/0\+SB X0P/ P ( \00  @/Dc\cpc@-@PJ 0/0*S  0x/P Td `0L/ P Q  40p @/X<)X* Y/@-@Px t0t/0X)S T0L/ P $ \0 E @/c<c@-@Px t0t/0X%S T0L/ P $ \0  @/ccc@-@P 0/0S  0/#P  0/ P Q p 0Q P l0  $Q ( L0$, 0 0@/T_< d(d@-@P 0/0 Sdl0l`/ R <0 P80 <0 0@/<p`Dd@-@P 0/0S  0/ P Q d 0wQ @ 0nQ 0e  0 0@/`d<|d@-@Px t0t/0XS T0L/ P $ \,0 > @/d<d@-@P 0/0 Sdl0l`/ $R T0 P80 T0 0@/<[d@-@P 0/0S  0x/P T X0L/ P Q  0 @/d<e e@-@Px t0t/ P L \0 00, P0  @/ R-  R2 R6"0S S S.Q   k! R  OP@DT dP P <P  ᫺  @ݩ` Ѝ@/_TY<!q"0q@-Q M@`Pp | t1t/UT T1L/0S ( ,1 A/P  1/< R Q# 0@/< R ^$R 0|/<0 SRPh0L@/ : mP @$<t Ѝ@/p`<Pqlqqqq@-Q M@`Pp  0/V  0/U 0/0S l t0d@/P @ L08/   @ Ѝ@/gdY<qr@-Q M@`Pp  0/U 0/0S  0@/P ` h0X/ ᧹ ڨP @< ឹ Ѩ Ѝ@/`x<4rPr@-Q M@`Pp  0/U 0/0S  0@/P ` h0X/ _ ᒨP @< V ቨ Ѝ@/_<prrA- QMP@`p  0/T 0/ ^p0\\/ ^L044/  MЍA/_<rrA- QMP@`p  0/T 0/ ^p0\\/ ^L044/ ޸ ЍA/Ha<r sA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ ᢸ էЍA/taȅ<,sHsA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ f ᙧЍA/a܅<hss@-Q MPp@` @@ <1</T$ 1/0S G 0P/P  0/ ' ZP P<  QPhhPlcP p^PtYPxU Ѝ@/_<ssA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ Ƿ ЍA/a<stA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ ዷ ᾦЍA/b<$t@tA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ O ႦЍA/|?Y<AxwBwCwwE0x@-!Q M@pP` $ 1/W  0/U 0/0S  0/P | 0t/PP P Ҳ  @ Ѝ@/<_Y<hxx@-Q MPp@`  1/W  0/T 0/0S  0/P t 0l/P Ⴒ ᵡP P@ y ᬡ Ѝ@/`Y<xx@-QM`p@P  0/T 0/0S  0/P x 0p/1PP P!Ѝ@jЍ@/d<xx@-QM`p@P [ 1/Tdl h1\/0S 8H D10/P $ 1/T RQ0/P(lP#gP"PPPP $DP%TЍ@Ѝ@/[0m<n voW $06 00W &0( 0"U 5ş/)P  5pE/^  5Dş/ R1Sx|5E/(!, (, (׾@,P 4ğࠑ/,( @0Rd(0, g:(,,0(S CS^W= 0 0U 4D/,^ \ T4ß/ R 0 ,4C/@P @P! 0 0% 0 0yWUt 2Ÿ/01S H @3B/Q  3Ÿ/ R2tB/ }U D2DŸ/cP  02B/^  2/ R 1SH 1A/(,,@^ 1p/,( @0Rd(0, (,,@(T,U^ 1/g^ p_ h1@/ R D` @1/ R 1S 1ax@/! 0W4 0 0Z<XZez{4{]Xp :ዶ\@Qs 1/X0\ bPB X\+SWPQhRPLh@\P | (1/X \A X\ S5P/0P*ᖹP%&P ጹPPႹPhP ,@S ;  PyhЍA/T_4`H`k]l G-0hM!S@P lb d2dŸ/P @c @28b/ Rd 2r/,㔟Xp 㐟E\ Q@n 1/X0\ b`B X\RᬷPSp᧷PNή@\P(w 01 /X \A X\^R኷P1ᅷP,ᛵ\0@S 0/X\@ X\dЍE/(bbkE-@dMPp,P `X0 8/ 0Rp9l/g d     dЍE/TbP$PX PXW @@ЍO/_ak] 9Ĉ2~~h$@-0,M1SP@` `/ X1X/P 40 41,q/ R 11/ pT ҰP. B0 P&0" °PP @0@4l EKP8? L00/ᣰ,Ѝ@/XjlH`k ~ E-0|M.SP` $ 5ş/ R5D/p@ᐮPtP 4ğ/p0t Np tP U tf@h &KRP HMPp[P (KtP 3ß/tp0A p t1P,Pp JtPx |3pß/tp0A p tPD Ppp@tP 3Ÿ/pt B ptJPPt0@St x2lŸ/pt @p t?P0 @ȯP ïP{p Ὥt@\ 1/pt @p tPa᤯P\ ật@PT` d1X/pt [@0BL pt0ZJᆯP>ၯ@P8,P> ; ủ4@t pQ* 0/pt 0d p0t  ϢP TP  A 0oP4E|ЍE/ilk]|] l29 ~E-0lM-S@`  3ß/P 3ß/,ݖ ږ Q ` PXၬ3\p@W 3 ß/X \cp0A (X\0IP\P\ 2Ÿ/X \0A (xX\0IʮP\@\  (2Ÿ/X \0A (X\0IᬮPnUV,zDzzzᠮPM aX P[\\h p1`/X\0 0C4 X PE\Q 1/X \0 0C,@X⴦   ۡP P&4@\P* 0/X0\ 0dX \0\ R JP XN 0eP,;lЍE/pilm]~& ~A-0 M)S@p` 0> (2(Ÿ/☫{@2PC 1Q/0 L PQE 1A/@@ 0hHPJ R*$H ,1/U2 0 ԭP5 ϭP0 0N PP#P*Q 0/ e00 `ᩭP Q DᡭPP ЍA/cPm](09 ~ E-0|MSP` $ 5ş/ R5D/h@ያPlP 4ğ/h0l Nh lP U or@h !HMP HHPh]P  HlP 3ß/lh0A h l,P'Ph GlPx |3pß/lh0A h l PDPhp@lP 3Ÿ/hl B hlGPPߪl0@St x2lŸ/hl @h l:P0 <ìP ᾬP{h Ḫl@\ 1/hl @h lPa៬P\ ᵪl@PT` d1X/hl ]@0BH hl0UGၬP>|@P80Pp85 ᵤ8@lQ* 0/hl 0d h0l ʟP OP  A 0jP0@|ЍE/[,[k]l 29 ~G-0M0S`P P 2Ÿ/ RQ2B/pᒩ. PtW x2lŸ/ pA@T @ F@P,P| F 0S^ 1/  @ ګPaիP\ F 0S\e `1T/  @ 幫P@9  S>  ᮫P5 ᩫP0N 0ĀP(0 # ᖫP  ᎫP |ᆫP    3@ 8JFv@ЍG/ jlk]l 9h$DG-0MS`P P 2Ÿ/ RQ2B/pƨb PtW x2lŸ/ pA@T @ F.@P,)P| E 0S^ 1/  @ Pa P\ E 0S\e `1T/  @ P@9  S>  P5 ݪP0N 0P(0 # ʪP  ªP |ẪP  1  /3@ 8~E᪪@ЍG/dmk]l 9h$DA-0M%S@` M 2Ÿ/ RN1Q/  ᗨ@ pPX 1/P0 C!@PPRhbPL x@pT(` ,1 /  @@ PEEP/0P)Qh 0/ C@ (P #P  L 0>P 4PЍA/cdmk] ~9 ~O-0MS@  5ş/P  5U/ R5e/`8@X P㜑㙑  ?PF8 ĩP@@pQ* 5D/ 0g0pS`@P 4圄/ pP`0@ X0 @p P` 4@ w倀 pP`vu@ 04 0D P` G  eP`z@Qx 3pS/0gP@ `儠D FP\@^ 3/ 0B 0C )PT 2吢/x0|@  P  Px A 0%~P~ (Pu`V* 1Q/` d 0@S 1|/ gP0N l0C ɨPEߦ@P  1/0A 0[P  zC ᦨP"`Ủ@PT| 0t/ g@0Bh 0[C ᇨP 0<( } ЍO/`klk ]P~lT9dE-0|MS@`  5ş/ Rtx5pU/p 0@ͥP Ꭰ v ᵛpP::P48@tP* 4ğ/tPp0 d pt #tPQ 4xD/pt\@@ `ptB P t PR 4ğ/pt0@ pt0BP t PR 3ß/pt0@ xpt0BЧP t PR  (3ß/tp 0A pt0aP  BᬧPp t@PT 2Ÿ/pt\@0@ ppt0aB፧Pt U 42Ÿ/0hlP vPp qPkhA 0|PcaP[tZ*p x1hA/t0ppe ptet PR $1A/p t\@@ ptB1P+tU 0/U 0hlP P P  hB0 .|P @p|ЍE/ k`lk ]h2T9d ~E-PPtM@``* X>XΟ/P P (0 ,> Ο/ 0  P  =]/oQ\ < Q Q Q Qr Q Q Q Q Q Q Qd]N Q Q Q  Q QQ QQ Q QQ  *Q !Qa Q@ Q QQL QN%Qi #QV $Q['Qn e:)Qo0Qp -Q^ +QQ ,QS.Q[ /Q]gQ 1Qb cQgQ Q Q0S S SQ @ ;K/X@᫣ yP  R` >  S     b '^]   Rx :t:Hʟ/X@XDPPK Y XE 2PP l\0S PPf\PUX_ j  R <9XI/X@ R` ?L9 ɟ/X@PP6\P3 ᇥPP.U PQ H R /@ ; 6^ . RP988 H/Xʢ@XⵦPPT@ BPPT 0S\C7G/X@ᩢ  E P Q~ n Rv  g^i F  0SWXf뤦<PPTPS 60v/X\@XP L6U/X\ NX \Q  6ş/Xp\P0@XP\0PSp 5lş/\ X0BWX\ 5,ş/t\P 0X%@"?P, 85ğ/ဤPP'T T P!W 4D/ X 4Xğ/<@ >X f>W\ t4ğ/X 0P4C/<@ =X G> P PP@0#>Pڸ 3`S/#PP\Z*x t3 ß/X\0 g,X \\0S'    b T ^T ^ KPP\PU أPP\x@L H D @ < }PP@lT< tPPdL0S< @<@PD(0! @?>M 3vQ  n ijp K፣`d R:P L1P/d08!>wd0PSUP iPP`L 0ἄPP X+PtЍE/ZZpdfnn@[k Xe p8{U0P P 0PPP  b@% 0 ShP   S@[ a\@ P `P:?)@@lЍO/b aO-QM p8 h2hŸ/@ 0PP:)ZP 0҇P t0 @/ .P87@ R.P㟠B&7PY  7PS @TXNPUY X YpqP@`~@ 0/8Pd@`ƄJ[0 0d@P ᭃ0 ᳅P  ᝃT Y    ЍO/^fxaO-QlMpᐰ $ 1/Y1X 05PP^`4@l@ 0@ @P' Z Z ]لP0S WZ X0P\P X+PP$PPX`0 0Pd)@PdPXlЍO/_aG-M0MQ@ᔐ - 2Ÿ/}p 0㳆PPr j 8`lT1@  J0冒@P̂PT)PR0$@*5p =0ᄆPB\ R1` (6ʍh `R 0Sʍ mM`.Ɲ@T :A (~RZpW!1*x 0 0S! ͍ZP0 PB$B ! PpЍڍG/p`E-MM` Q*@d 2 |3|ß/T \3 \3TC/$ 0@P:0 z(r0@-(@K4Pd@/PG-M@  Eq0PS` : 0CSp1p#$T@ p U, p@' PU% p B,$TPE`\T@ W @pG@PU*T  b0L00qЍG/A-cQMP,  0/p` 0ʄ@P0SS@Pp W@ЍA/jO-#QlM@`ᔰ # 1/T $ 1A/\ 0㎄@P_`QP P> 0P7`Pᮀ)@H P+ 0lP$p 7PP3 0_P +PP' 0SP  PP 0GP @ 8P |YT0 0PP d@lЍO/T_|YE-QM4 " x0x/p` 0 PPp  @P 9PWЍE/`d؃E-QM`4 ! 0/p 0PP @P 0փPP0SS  @P PЍE/t 0X@ l U0P h2}@,tmxP%t t04m`4@hp#~Zx0 0Œ@P  } k@@ЍE/pip&E-Q|M@ᜀ ) 2Ÿ/\` 0㫀PtpPpPPP p` 60P!!-*p0S W P\p0 ㄀P~w`PPo DPr0 qPk`0S|)c w0.P\0 [PU`1PP0 OPI`hPP;h P?0 >P8`lrPP*lP.0 -P'`P"0 !P `8PX}Z\0 0PP @| k|ЍE/[0G-0QM`4 D( <1</  0@P > PP$ ^P2  0P+p 4PP  㖔P  0Pp /PP  {@  ~P9 S   j@ЍG/ juG-QM`4 D( <1</  0@P > ᐏPP$ P2  0zP+p ؏PP  :P  0gPp ӏPP  {@  "P9 S   cj@ЍG/dO-=\M$@`T舰 5 =}/@DpW@0@ U@VT @POHZQP 0PCHP(+.P @  $.P @ P  .P P*;X-Z^X00 S$ 0~PHPx-P @v \-P @@p  m.P0 R.R ;PX.R? 0:P P Q P yP@ 0"T  @ TP@P dPP QPU[ OzPgzH@U(;0@ +/ DPR00 S% {~PH@-P   -P *00DP 0`~PH^0 U~PH@<k-P  d-P P -Pp\;PPW00 S *~PXH@@-Pq t9-Ph  -P0 R.R;P.R?0;@P@@P0 S P P@ "T   @TP@P P P0 SPU[ yPyH@U@80@ 00(/ DPR00 Sk }PH@,P   ,PsD@ 0}PPH :-PQ.Q mQ"aKX*>S#.QP @P m\\  P EP X@`T @TPm\0P0P@0S&X[P6DPX_[^  0Q}PD@ATeP H,Pp R.R mR aş W.RPPP@P0 m^^ P P@I T% @TPmP0P0P@0S6W @$0WT  @X!4 U  D@€0W|PDNPyP Hw,Pp R.R mR_\DWb.RP0PP0@P mQQ P P@ T% @TP@0mS0P0P0SW@ $WR@@X 46 U , D@€0V|PD0CPP H,Pp R.R mR BWDx)@.RPPP@P mQQ P P@| T% @TP@m^0P0P0 RiW@ $WR@@X!40 U0 02U0T POW PIV PCU ېP=@T 41 ,! ,! b@lѾP$0S  .A  @`0n帾P Dxt@aKd*>⓱ 媾@\ЍO/ሉhhįdxȀX8~(\`yՍJ]`6E-%QMP4 @# 818/  0{@P p= `P  w@2 P,  0{P%P: w)@ P0  y{P`@P  w   5P  {f @ЍE/c,O-*Q,M@pT & 2Ÿ/T ' 2B/ 0={@P0S` !Q[` *  :RP V Zh*/6*`P VPwBy' PPZZ Z7@  \*/PQ' \X@T@,0S@(P@$ R@ P   ?*/P9'^; (0$@ST B@ r@ w@2 @ MP'' P" ݎP ∏Pv v@v`@vP@ v)@@v,ЍO/XzYE-gQ,ML` H @3@ß/@0 @@ @@@yz@Ph 0xQf zQPP @P @P @P @P Bj)P ^0d00 ^  1 d0 0*!0PdP.  َ@Pt ӎ@Pn ͎@Ph ǎ@Pb@@[ 1A/0 @ Rp 0z@PF0cnf0 y@P:$P )$\(0 y@P) |)$0`P0 y@P l)$ R Z0V PD@@@ @T,ЍE/j؁Z]G-QpMP`ᔐ ( 2Ÿ/\p 0y@P 8vUV02 ` 0p`P u@w 0{yPo` QPj 0oyPc` EP^ 0cyPW`xaP PO0 TyPHnމP h` (h0S yuA7P' P+\@0 /yP#``P P ` 8dP0 yP`PIu)@ P `  d @pЍG/ kG-QpMP`ᔐ & 3ß/U ' 2R/\  0xPP @8pvV2` 0崄`P  tP  0xP`h y`hp0S  tR{!0@V(" 'Pp |Pk  0xPd`AP@ P\  0xPU`P2 PN ` cPH  0wxPA`P P:0  ixP3nP `h 'hP\  tP"P  P\@0 DxP`P:st)P P ` Jc PpЍG/`Ȅ܄@-M`ptP V s80P@@Ps 0/Ѝ@/x-@-4@ M0 0 ( ' Ѝ@ Ѝ/@-0MS@`p O 1/P  0P/ R0/PLR@uᆅ ~P@Q*Ld `0D/ 0d  uЍ@/`k=l>kE]A-@MPp`ᰀP0 K/ 0R/Qst8 ~P0@TS\ X0D551/1 0d 0(ЍA/`l kk-7]A-@M/Pp`PⰀ0 / 0R/Qpt% @0Rl d551/10d 0<~0P ݋0ЍA/lik]A-0M.S@` HH D1D/ R ,,1 q/pgQ݉ 㯋P2P 0@/0P C tኄ@Q*`M p0\/d }P z ЍA/ilk-]E-0M&S@p d \1\/P 8 810Q/ R1 a/㰠P n@T 0/ nP 1`P0S*x 0p/T 0 @`e`s   j}`ЍE/_nH`k~]@-0M$S@pP s 1/P t 0`/ Ru0/`P ֊PQhz p0`@/0@ C 1s᱃ }Ѝ@/l_~H`k]A-0M#S@p` P H2HŸ/P $ $2/ R2/㰀8Pᮈ 《PiQ 1/0@0  iPR@@Q*8 @10/0d0  OP8@@Q* 0/0d0  5PP@PQ*h p0`/0@ e r  m|ЍA/T_4`H`k]A-@M!Pp`ᰀP0 / 0R/O P x0Rd \ࠑ/0A0DrĂ $|ЍA/\`<_k]A-@MPp`PⰀ0 / 0R/WOrʇᒂ @0Rl d551/10d 0{0P 傉0ЍA/`p`k]E-0MS@p`  1/P h h1`/ R@H1</㰀Ow IP:Q 0P/0P C  q# {P@\*d l0\/0 d  q e{ЍE/``H`k]A-0MS@` HH D1D/ R ,,1 q/pN  ߈P2P 0@/0P C :qẁ@Q*`M p0\/d {P  ЍA/[,[k-]A-@MPp`PⰀ0 `/ 0R a/ t0R`b\/)Npᜆd zЍA/kgH`kA-@MPPpḀ`1 }/ 0R~/M_j0 S" 0Rp hࠑ/ A _p tzЍA/`$_k]A-@MPPpᰀ`1 / 0R/ME_0 S" 0Rp hࠑ/ A Q_DpĀ $zЍA/`_k]A-0MS@p Py H1H/ R(z,1$Q/KoWMpV_ pƅᎀ4A\P* 0/X!\d X\yPs4A\1S*L P0D/X\d X\yލA/` ak]A-@MPp`ᰀP0 / 0R/Lj <P x0Rd \ࠑ/0A0o yyЍA/ a^k]A-0MS@p Py H1H/ R(z,1$Q/KoLjoV_ fo4A\P* 0/X!\d X\1yP4A\1S*L P0D/X\d X\yލA/_4ak]A-@M PpP`Ⰰ0 e/ p0R`f\/ILoἄ xЍA/__kA-@M PpP`Ⰰ0 [/ p0R`\\/LnዄS xЍA/`aHakA-@MPpP`Ⰰ0 [/ p0R`\\/KnZ" xЍA/atakA-@MPpP`Ⰰ0 [/ p0R`\\/Ktn)~ QxЍA/aakE-0[MS@p  1/ Rtx1pQ/K_KBnn >n~4AdP* 1/`!dd `d xPP) ~Ad1S* 0/`dd  `dwPP V\\!RP`X @ ][ߍE/_ak]A-@MPpP`Ⰰ0 \/ p0R`]\/KmႃJ~ wЍA/aakA-@MPpP`Ⰰ0 [/ p0R`\\/JmQ~ ywЍA/(bbkA-@MPpP`Ⰰ0 [/ p0R`\\/Jkm } HwЍA/Tb B R?@@7 d 1_ R/'\1 R` #Y 0S%%,*J > R c6 Rl$1@/C $cY P@3":00 Q:P 0H/HP@@ЍA/ZZXZdfnne@[XeRD0S@ <P@ @ 8SVRLЍ@/b O-tM☀Xp`ᜐ堰< < 8=8͟/ R 0    =M/WL3 4@ P@@ @lTP :x i  W%W #W $Wx'W :)Wr0W! -W  +WK ,Wg.W /Wb gW+ 1W cWZW0 :W6 WR#Z Z ZK0 ǻ|0  u0  肻n0  g0  `0  `Y0  8R0  K0  D0  =0  n60  (/Z`Q XPd R(R)\^ :`XY dQd0  % ᙵ@P60  0   ᅵ@P R 0  m0  -XQ\@TG e@P0 S  \0  ZXQ\ R X @y@P\ Z|0  0  KZl0   '@PXj ZYXMQ `bP\Pd^pX `Q `@6Qd Rx `Q@[RqQ  \m!2 SjSh Q 0 Sb!2 S_S] Q  ^W!2 STSR 0B`0dxwtşt% QGdP\& T5(ş/` d0@`d0`w$$%Q/PPQ`  0  5Z0  Z0  Z0 $ Q`PdQ"Q`d Z0 & 0  `PS`d @`@"wd@Qu 3xßࠑ/d` @0Rd`0d :`dd0`S CsP XO\@T: `XP OyZi0  N0  0  0  kXAP\Q?ZDX8P\Qz 6 @P\  RB X'P\'0  ^Z$0  UXP\ RSX00SRMS#RH0$0\0\iPX\ w7 `T   RVP0@S-Q@+ e  h0hlu@@4 P 00 P@ @)@T@tЍO/Z0XZ$ O&h]d?Mc E-pQLM@PhI kvPE 08 DbP<0S)P#:*D< RPP4D< YPP*D@< RP$qvP(`  [= O 0 `MPr=EN  RPDQPLЍE/\FO-!MMʍ@ATp`DL _P T L?L_/^ 0  $ ?/ P1S  R>Ο/P RB>^/:=< P0 倠.$ 0͍4  0aPP ]@]*P0 P'PJH1 0P ]W < WF W  W Wt WW W W W W  W\]u WWg WC  W* W2WF WNWx W_ WgW y*W !W] W W W W< WD%W #WW $Wa'W :)W0W -W$ +W ,W.W' /W/gW 1W cWW W WxPX* X3 Xo,  04aPP! @:0 P1P \]d[! >MʍQR  ]M ʍPQ0 PP-  0aPP!L@\ P1P )]Z ! MZ j *M ʍPQ0 P%P P0 PZP 0PA @OP ʍPQ0 PP P0 YPx 0PA @Pm ʍPQ0 PPb P0 DPWX 0PA  @FPJ ʍPQ0 PkP? P0 P4 0PA @P) ʍPQ0 PTP P0 P 0PA @P ʍPQ0 P%P P0 fP 0PA @P ʍPQ0 PPX< P0 PX/=(  0_PPʍ-,P*]⮰T|6 @, 0kPP \ 0PA @P P0 $PXX,A  0_PP0P0: [)P -PP|0  _PPuʍ,\-`TD5]@ , 0ykPP [\0  _PPUZ,\=@T4@,  0YkPP@ [< 0PA @>P1X0  V_PP&X,@L*  P [S !aKʍPu  K  ZP0 P 0PA @WPXS ʍP0  PXF ZP0 ZPX9  0^PP:P: ,[)P rPP0  ^PP͍ ,P \⤯TT2*@, 0jPP [ 0PA @PX P0& (P  0^PPʍ-,P[jTl1@:, 0jPPk ZgX 0PA @-PZ P0 PO 8@ 0v^PPFPZ)P= rPP90 b^PP2ZPZ)P)Z<GXZJKȂ#  \rPP  UUP 0 JP P P0 P=,  0^PP ,PR[֮T0*@, 0iPP 9ZX,A*' M ,@0]!̍PP⬠ZHuPPx!!@Q 0P# Z &! 0C, N\@T: qPP@ qPPX ,B  rPP Z 0 JPQ PPxX  HPp P0 Pe ʍP0 PZ0 JPQ PPOX P0 sPB= @ 0i]PP9P:Y)P0 ݦPP,0 U]PP%*PY)P cqPP0 A]PPPoY)P OqPP  HTPXX@ 4 UZʍP 0P U PP")HYʍN\ @U PT ͍4PU\ :P0M4@ @P^*P ^UQ $0 @  !Lb0J  oU# : $< ͍< Z 0  P$PP@GߍڍO/@- 0MR@Pp ` 0/ Qx0lh/ )^T0D@/vo so ᡊЍ@/̂cp@- 0MR@`  0/Q  0P/%^  0/ Rp|0lP/ RL\0H/P+o (o  @UЍp@/ĉ$8Lp@- 0MR@`  0/Q  0P/^  0/ Rp0pP/ RLll0L/Pn n  @Ѝp@/ĥ`8Lp@- 0MR@` 0z (1(/Q { 1P/^ | 0/0S } 0P/ R |~ 0t/P P `0HP/P|n yn  @ᦉЍp@/Hĥtp@- 0MR@` h 0/Q i 0P/^ j 0/ Rpk|0lP/ RLl\0H/P-n *n  @WЍp@/`d̂Ѓ8Lp@- 0MR@`  0/Q  0P/^  0/ Rp|0lP/ RL\0H/Pm m  @ Ѝp@/d̂8Lp@- 0MR@`  1/Q  0P/^  0/0S  0P/ Rp0l/ RL`0HP/Pm m  @ᰈЍp@/d̂8Lp@- 0MR@` i 0/Q j 0P/^ k 0/ Rpl|0lP/ RLm\0H/P7m 4m  @aЍp@/a ;a  PJShЍA/Hâ8LA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@mP`p iPX`ff` `  PRhЍA/tâ8LA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@P`p  PX`ee` `  PRhЍA/âԅ8LG- 0hMR@P  2Ÿ/Q | |2tb/pW P T2H/ R(42$/ R2/,pO` OX ee be *` '` 7R`P \4@dPU*l 1d/d `P\d0Q`0d*$D 81/\0Xe X \wO tO _ _ R`P'4@d`V* 0P/d `P\0dS`d*P d0H`/X\e  X\+`hЍG/_̂8L]A- 0hMR` ,o $1$/Q p 0@/PU q 0p/ Rr0/ Rs0@/,@N`p NX`ddj_ g_  PvQhЍA/â8LA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@N`p NX`IdFd_  _  PQhЍA/b̂8LA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@=N`p 9NX`cc^ ^  PPhЍA/ `0,3@m0 nJN0@P P㑞.P J>^,0   %/,0 ,P00`,`00M. S  `vdMN m   P@`\ ! 5/@ TP`@P V PU P  t4P@IPίm4 $0 4 C`0D$0( ( H`PnM.-ĝQ  \b://0SD EN,0   -KNU @ 4 SK΍  P/h 0R:a@^:\ 2TŸ/ h$EbL8# /  U 40 S403P P @``@^@V@T (0S: 1/(  ( 0C.Dč$^: | x1/$  $5͍@00Z ύ Z  !P !0XY @@Y 0P X0X @PKίP @Jί @POЍۍO/RSNDL9:;B^_$mu0~<T -M $Ѝ/A-M@pX`P@d# \0\/048<  0nЍA/Ԏ-M $( ,ZЍ/S 01 0P1000:0ʀ0RH  /@-@Pdd `0 X ^ P/,0 S(440(/,@/,@L!seR-ȏ@-@P88 40 , ^ $/4@/@؏!seR@-@P88 40 , ^ $/8@/@؏!seR@-@P88 40 , ^ $/<@/@؏!seR@-@P88 40 , ^ $/@/@؏!seR@-@P88 40 , ^ $/$@/@؏!seR@-@P4 00 ( ^ /L@/@؏!seR0@-PP@M< 808 0 ^ (/L@Ѝ0@/@؏!seR0@-PP@M< 808 0 ^ (/EЍ0@/@؏5!seR@-@P88 40 , ^ $/@/;@؏!seR@-@P88 40 , ^ $/p@/@؏!seR0@-PP@M< 808 0 ^ (/p@Ѝ0@/@؏!seR@-@P88 40 , ^ $/0@/&@؏!seR-0$ M0V Ѝ/D@E-PPKMp 4R  4ğ/,P x 4tD/WPd `4L/0 (DD4(ğ/00 - 8^ 4C/@8%$P~P  3ß/#3YP`Q07 <X,d `3(C/ @<#P}P $ 3Ÿ/a"3YP@ 2 02V@ `aQ`@;0 "! AC $ 400PH$100 J 0 Ÿ!)E 4$ 0P)$10@VJ0`Z  n$ ῆPFO  `!t% 0 + X@p-0S@ ^*T!@!x0U Q@0S*T!@!0UKߍE/!seR@Lȏ\hĐ@@p@-@PP`0  t ^ l/L0SPP 0d.,0LS88 hPd`0PY.p@/؏@!seRL|@-@PMP`p 0R  0/P\d 3.U00Vh00Wd00 0BS0(( ".Ѝ@/!seR@؏L|0@-@ PM0S 00HHH 0P . 0,C\(( P -Ѝ0@/ @ܑp@-JM$PU$  43R  (((3(ß/0 3c/$'.0Q"-`@P0 L0R "- 0S0t"-0 M"P @l h2<Ÿ/0 0(<"P 0 $2/ BQ"-0 !:@ CϠ0I0 4$ 0.P @k!0G0 ! d)E?0 4$ (0m.P 1@ik 0bG Q <-$P A4)$10 Q A *) 0AS0tP  -Jߍp@/!seR@4L6h; ?8KdO:TV@ĒX  0@-@PMP \1R TT P1P/U P , (1/!0!@F0Q ,|P  0/xQ 0|/x 0Sx0L 0H/APdd ,@Ѝ0@/!seR@4$5ؓX  89;,=D>\0@-MPP@ ||0 x p ^ h/` \0  40PP 0 Ѝ0@/@؏!seRp@-@P`Px0xx  l ^ d/``0P 岙P00U, ` tp@/؏@!seR<@-@PDD @0 8 ^ 0/`0`Sq@/@؏!seR@-@PDD @0 8 ^ 0/\0\SW@/J@؏!seR-MC=Ѝ/p@-M`PP@0  ^ /\ ^0 ud0!PP  0 QR0<Ѝp@/@؏!seRE-PM@P  p1R ddd1d/U)L\P< \0 PB\ (PP9 `奡$@TP` 0V( 0UpP%  TP  ,U E` $p P0OR  U 00E` $p0\ LЍE/!seR`@؏vE-`P Mp \1R TT P1P/,P (4 01$A/x3W  !R1P/ 0tU@PP) WP | ᰣp|7 ?PP 00 L0Q T P@TP@P T@ ЍE/!seR@؏)A-PPM D6R << 868Ɵ/DPP  6F/Q  5e/qW  5尅/$^  5ş/01S \ 5XE/!R 0` \5,e/TP < 85u/tQ  5Ԅ/%$5@@ğ0$@ Dp^0<`0H P P 4Lğ/H 0 @T00 HQ L L4샟/H 0 @XA```0x`Vt0t0 \Q  3ß/t\t Rx0x0 X1S < 38ß/xX0x0t0H || 2P@T`A0x`Vt0t0 d\ ( $3Ÿ/tdt^x0x0 `Q h 2dŸ/x `!xtH20| 2P@ThA0x`Vt0t0 l\ d `2/t l!t^x0x0 h1S  2/xh0x0t0H | D1P@T ⋇F4`E4&9PH`=`PpH =_G KH@ @1O@@H04,|0OP P d!d) B0@\0 8 Y)H0P |3ЍA/!!!F@ ̔ H  ܕ, | ̖  LX   ` ܗ  0P p @-0M@@t0pp  @.CH0SD 0RXH0 < !H~Ѝ@/LȘX  p@-PP M ,2R $$ 2 Ÿ/@T Q  1a/1`!(@!0 B<H  "0S0l!(DQ004@,(P.Q$0$0 0S D @1 /$  $P(0(0 0S  0/( 0$0(0 R  R @1 0 '}<H ,0CQXX g( Ѝp@/hctF@vԘ!!!Fx̔TpX  }|0@-0 M@03(PU$0$0 P  0/ $ $^(0(0 0S pp t0l/($0 ( @|P R Ѝ0@/@Dh@- M@0 B0S 0'0tSx t0t/ BQ 40LS@@ 0'Ѝ@/ؓX  @ 8E-PM<< 828Ÿ/`V 2R  2A/@T Q  1q/ 1p0 `@崡!0 A< H 0\@xx!'DP ,(P^~' \DD!TQ0 ,1/T0 CRT P ^ tQ s@5@H 0@S0P K' ,0'NT ЍE0ЍE/@hctFԘ!!!F̔T̚X  ܚ0H0@-XAMPbwPx@TЍ0@/0@-hAMPQwPx@TЍ0@/0@-`AMP@wPx@TЍ0@/p@-M @T 01R (( $1$/P!&|PU  0`/0h SPC^P P00 l0MPp &` LR Lpp &U dd` `0`@ &Ѝp@/!seR@L :8 X @-D0$MSP` P H3Hß/<@8ß8s4#40 p @@pe(@T$0$0 0S  2Ÿ/$  $^(0(0 Q  2xŸ/ (000 $ ( P00`V@PP3S .S S   2/@<P  @0P 0L3 NR 1/zp@ RN PPK  d0W:SE`@T@ 6`0'.0K`Ѝp@/F@\tJ@-PMP`CPp|@xßP@l0h# +>d0 L D3Dß/ Td@U@0d0 T |Q 2Ÿ/0  P  0TQG@P | d^x@dQ`AtPxdA`@ @PP0<H `&&|"2/G@P | l^x@lQhAtPxlA`@!M000 (QPPP``u@Q P0Uk PPeA PPaB. P \+0X PP;` qo΍ P'` qN0@P$`P 1P`*PPh h 0@ 0 z6'Hǝ\=RDP B. FߍۍO/0 X 8 Lt@?ndD%A-0 Mp` + "i $@T 0HP  GP =PU @T P ЍA/TO-06@,v,Ɵ4MR`&0p `5Zq "  .Pb  ^0 0S$ 0p03$0  P_0 "  ,-P,0$@@A!.R!RRPP  ,-P+ U \Y ,0 S!,@,<0 X !R R ,Q ,, 0S+  000!1 @T u P P$P$ = PI@0 "  ,-P,0$12!.R10/S$0,S00;<0000000 R+SY +RT ,\,@,0  P̂  0 1! Q ! P P$Q 0S#+RQ\ )P P)P@ YZ{| 0Y0QY Ys_ Z]P e)Pi -P @!0 `4V R 1A/d { 00pP2*P( $1A/p<Hp @.Pp &< H0 7# a/P0 S0<0$QZP 0 00T 4ЍO/LX  [@̢8/A-@PM`p H1R @@ <1</P 0lP5`j,@p@3W0$0 .PPP 0 00 \ 0 0 PP 0 0.P P 0 ЍA/!!!F@a̔G-PMxPU`p|@sPpt0  P-lp0@PP !R00@ @0@0@@0 UPPЍG/34p@-t@pQpM@0`!`P@ 3P0UL0(@H`DE HX-P0000088!8<< @P 0/@ R 0/@P@@(DP D0S l |0h/DP ~P DQD(@TЍp@/L X @Z [ @_ `O-UM Mp `P02@,Ÿ,B(("0@ `K3<H 0##|!1uC@Pp | \Q1Ux@\!XAPZt xP\Aa ZP0 WCSNK? qR7T!ZS>CpA? Q @U.,@ #QH5T,8PPEG+1@ >K~@pOn@ `6 ? hd @C>,Al@ 0 Pp `2WߍۍO/LX  @XZ x -( M0S#Ѝ/O-@P嘕EgM0`%P @2< H0^ P5  N"<%@8T@10UT@!?@`C_ᗩ0A/vP+tP  4ğ/#< H@.'$4BPP  fPlbʠ$?)0 `4$ 0`P^j Q 1a/`0!\0 (X, P 1坛`P2l0 l 8P@xA,!$0 @1`P AT0P @Q,0@ Q! eP(P !CY D` H<,00'.P0> P8pp . gߍO/LX   @B@Y^m@!!!Qa25O-tJ@pMlʟlZ`0\\*!10 H H D:Dʟ/pPs7)@)0 p`0 P @I||)0 @`0I?.8ȟ 7:8@!<@: S<1S9tQU6<H 0P!ST^@f@H 0AS0 BkT .b Z"xR$Ѝ@/!!!F@;̔L\X  BhI|Xܚ_Hp@-(M`2$ @R LL H2HŸ/$ R `,V   2 Ÿ/$ 20@@a!0` )$ l0@l0$d` ͍$tS,@ TT6*T4 T2 T @ T- 6T<*o]$PP0 0 $ : P$❍U$PP $ 0w⌍ 0$lP  {$ 0[pb(Ѝp@/@%!!!Q$ X 0@-,M1$ PR  1/$ tp1@d``!0 a)$@hQ 41A/$h0@h0$d@ h R.Q $', Q 0^ 0$ b tP$ 0K,Ѝ0@/@0X  <PE-P`,M$PH<@ `\!\1Pp*9PP`M `@t1S $( $1$/aL0T $ H pP( H0,`P p\  0/$px$ P|$t!x$0x$|4$ x!  <H.D00 0j5,ЍE/@TPħO-8M@MȟHp  (0 @p( H< @"0S0(W$$B-@"$|  tD<<@<(<H 1@S,@ G.4  y1Pt[<(\1S0(0t4@(@8 tĝ08088 r34LX0D0\0@040&ꌰ[0DX\@40 H !8P@3<S.SD S@ X\4 @0X0D 4\ GN|  0xč2PP@0$PHT@P@0@#0  ( `Fn + `&F 3 +H RƟk Ɵ0% `'0 GN|db< (0,RtQ Q !.R$`.P1S `V8  !\  R @0T@!@@ !LX@Q@| x0@ @ğ@ P LX\P 1S0 PV L@T\| x0@@\$@P P  80 S"B& 3S.S S T@P P` @TP{  3ß/P`TPo(@,1  @` .@((a ^ 1S#0 Z 'St300V l38h Pß/H300K0@HX@\ @@  1S#0  'S200  2Ÿ/0P 1S .S^|0x @ s\2@PX @Q@"" \ 0 D"0 P ,0@ PUT\ 3(@,P  @ @4TP% [00 @P @Q 00C3@\4t p1H/0 0 @| G|D jxPG|(T$P@ T$0@T$@ @0<H, BQ d P  DD 0P `d&@ЍۍO/LlX  @Tܦ|la ,34:Ъk|p@-@PM`P ,1R $$ 1 /U 1/00P  | R \@ `!va  0S( $0( @Q44  Ѝp@/!seR@JLKP _8O-M MpP $ ,( 0  |=Q t t p=p͟/, RL XX=L]/ `V ȝ\ ,R   =͟/8P < Q  <\/hV  <̟/P \  (( dP80T1TQU $k8PP0P@ 0(( >@PPH 0 PP H  PP H P PP8<  PH D6ş/HE/4 0>PPnQHPF  4PPb"M@ ԚA⡝P G0%MC ŚQHş 0 `  0hP GX0T%4|Q(_,Q(@H$%P PH@ 0S``H P@PH  ` `V `$T  `@PVP `2 $H -* m"P4j PH  0l8WP 8H< aH@ 4D#|/@H0 ,3/U3HS@CD#08^ @)#@H^`"Π8x#q `P5^P9\ß?0#HP#<@t@Dȝ8@†, , @M FvDQ ^$``$P(P` 0R(``$(0`TRT, PX& U"X,0X0'PȝL2P 0(P8P P$ 1(H0 ]Q H N\!U,1!0@0 ",8p, \0P/ꐀhPYH P, 0A/PЍۍO/!seR@L0RSND<ȫ D@<X    8ܚ2Ȭ1 ܬ Ltw  <^ 4!!!F p  LhctF\[gdHThaj-4M8< @DHLP T$X(84Ѝ/p@-@P(M 3R  3ß/, R2R/2Ÿ"0@!P"| RPUP X 2TŸ/PP 0BS0LL"U| Ÿ<R"0P@!<!21PP&P!0S 1/ R ` 1\/PAPG (B `V`dd!n````HL @ 0P @`D P0BS0!QU  0S0l G\P 0L/`AP P 2(Ѝp@/!seR@L0ؓTX   h8    <Э O- MMR@(, ?R  ?ϟ/`Z< |_[ `p l?\ϟ/ 0XS 0L H?,_/,4?P00$@$/0  xTP!cb |0S `qN P1Pp.[ ,@T Th`@d 0<`<` `NXQ P` C\\Q P,  P+ [ >[ @`0@,@h   <040 `@+ 0<``P  4 - `%P, {W=,0>@P P  0 \ `<L{@ -\h|(̝, 0@7  5PP8P^ |`Z  PU @q'8F ,RK΍ @ n8P50p03UPPU@6h.hH+;50P,P(0#@0@ QD˟. 00  @? U ˟p+p0P@Z :P, (P?P X  :Tʟ/ 4 R  <lJa<` $ \`> 0P F P B RP0 8 + <P@p+Npn + `? vwTǟ0'0  ` \L@3@p Pa PBF&0@V̝  `(6P pP0S P! CTT f.  <\$@\ Pr @T yP0 Q2 BP0$N <$@1S PPS  P  yP? @T F0S pUp开0 00P$0PEM@Dp+ +@ )~ p@ "n `? S#,ğ(L$00p` 0   0PP 0SSL[P      xCPCK y:w@pH`#`0 p!d dP %0 l0sDpppTL`\PHN d@L `P X'0P $PL!D, R00SH\D^@+.R D!RppWHH0!R00S D 0R.R /R !΍ RpP N @n ` ^QpP   `9@L`T 0 \p1piX[ \ 1Xp/PTP l0\R!!!Q@!!!F̔d $l@@XtWZV1 Љ2 x   DlGT8` X p|4ȯЯ[]ܦ_|@XYLX  XpWH00 V ΍ ` 0  PU!X$t01'SXTpXP'S,> \pP>N. @   PpP1΍^` 0P@N`, "] PE0 `n,`%  0 p 9WP WP@.SO'[L P@CP`P@0P,Pa P t P8 `$0,V`>  ,0  $P `" PUp aP V  L ,P`  `d6V#@@ ,`@@̝'0@ h< ppp,,,PU L P7PW/([ (@p4 D$P<S( \Q0P<P8輝 @L[ 伍 2̝$0 0SP PsT @3P@@<  HP`p `a<H`,0S0t(P P` @TP` pHdP1@`8^ 0P0, R` [ @ T  0^N )͍ P.N @   [ <Pp0)m 0A `( t <H ,P A 0 .V @0+  > < Ck[0j+@40+  T` [W  v @ F^ @0,@L,0 @(<͊oO0  @````0 xP  <H@ 0S0H ``-}T T H<!0CP -n P [[ W꼽 =A&DLPUQH0p#RppW `L` @` ~$` 00PNPN@`N@ 0>^ 0P 0 Ꜿ@.0 >.@.0 - AߍۍO/O-M4 4,R  4ğ/4`V dQ HX T4DD/@T`08D@400$0  ?pG4Tǝ 0P `%P 0@(('(ǟ 0Tǝ 0 `p P @&Ɵ 0$@ [Ks> n~gP hFP(ud&Oj. &P(p +H,Ɵ$ ` &0 p`Tr.c>P_T @,  0P@` p`P@ 0 p ``T90PPP <To~P0  q  Pr_n@`Uc΍P  !_>8 PoN0 U @crP`T T@$PP o 0 9p_^r΍P@W _nPcpPo>@P(` 0p@ `@*p 0 `@@W=0#PPVvPo 0 P_rN`@Uc΍P Y_>oP 0 l@r.cnP`T W0Ÿ PP6 |o  0Nr^_@^P _N@BP c>@;Psn g2P` P4j #L EP0!8gP+  $  0l @js~n^ pPT `( gNPj @PߍۍO/@+3 ,8X м :HG-+MS@p 0 S 3ß/ 0 pP_-&n @|& @ )PX  0$H` `v; W@00H 9@)G2TT@TT``P*r@bbbD OӾT 0@`` P@/`PP<F #PD _2PPP=Bz⬾,?S S SP PhQP z0Sz SPPzOPվU @`P P ``OPQ*2S\V  Xxx 0}@ +ލG/@pBؽX 0- @1P 0/0@-@PPM pp0p h ^\ T/ 0 U< 80,ࠡ/Ѝ0@dlbttsDc0@-PP@M dd0[ X ^\ D/80T ,TЍ0@d0ttsD8!0@-#Ƞ@ d\ X0\ ࠑࠁR 0@@P 0@/0@-@PPM LL0L D ^\ 0/ Ѝ0@dԿttsD0@-@PPM LL0L D ^\ 0/ Ѝ0@dԿttsD0@-@PPM HH0H @ ^\ ,/Ѝ0@(d|ttsD@-M@0 0 L\  \ (4"! /Ѝ@/@-,M@$0@ v00Ѝ@/2dp@-H @D0@P 0 P`@R`p@/d'- M!!Ѝ/E-@P Mp 0RP  0/`P!` 0 0 /P V ЍE/ttsDd|E-PPMp 0RP  0/@ 0R@T` @0FT`0 = 0S(8 40$/ЍE/ttsDdԿ A-PPMp` |0RP hh d0d/\@p`  T 0@ЍA/ttsDd0E-@P Mp 0RP  0/.`P` 0 0 /P V ЍE/ttsDdl0@-@PMP 0R  0/U P x x0p/0QHP _ AR ( T@Ѝ0@/ttsDd8O-S Mp 0S 8 010/ !0@P< a 0yP!  0qPP  m+ @  P0P^004<  0 ЍO/dttsD@0@-PQ@M V<0< \ ,/0 Ѝ0@d0@-PQ@M <0< \ ,/ 0Ѝ0@od0@-PQ@M R<0< \ ,/ 0Ѝ0@Tdp@-`QP@@0@@  \ ,/ 0p@:Ad0@-PP M R 1R  1/@00P b PB@UP WPU  !t0/ 0P0!X0&P^004@ : 0! Ѝ0@/ttsDd@E-,MPȰP{$ 0 弰Pl$p!{G0@Sh H Qd@TaژQXP dQ q3 TK\H;PE <RB a^%%<`&:EC@Po PoQd߇QڇQXڌ@P`@͇QȇQX0T0Po@Td`,),ЍE/`]Q3@-M@ iP00Ѝ@/G-Q0MP`<. 424Ÿ/(r$2pWu PU`dQ〇Q11/RQr@dnPU`\0 XQ 00t030d! ?SR8@P`VU 1P`VU*;@ P`V;U@0  PJ (Vᬯ,P P ) (寯 o0ЍG/t '3QQ|G-Mᓁ 1@pP`@P` XW ?ЍG/0@-@PPM 0 ^ /Ul t0 \ \/P \0DD04/P0P0@Ѝ0@/GGISTJP0@-PP M |0||/ lRh0XX@/@00U/8 0 Ѝ0@/l A-`PM00 ,1,/X 1A/0S  0P/ 0@PP$ p .PP 0 P 0]PP ]/@0h PP4@ЍA/D0l0@-@P0  ^ /L 0Rx|/L[.PH\ L0 :YL .P00 @/uGIST0vLz -p@-x!MM:@`(XPO T@ + @\5 ;,@ 0H@֭ B<+ 0*@@P @DPE0P@ P +x0@@@Dpp 0P@   ,0C 0Ȏ壭@Q Ѝۍp@Ѝ/P 8 A-aMMa.`A^^PMN @R^A΍0 Q1PP <!iO  XAN^ Pa>VQp$@T  P00H0l0@0H@ R PPH DQ R:^>A΍ qP PP OߍۍA/8A-pPM`P 2Ÿ/0S  2B/V\p l2XŸ/U4P L20B/@3-P$$"W-P"d-P!00. ;XPP-PT \X 8'P -PD ``!? HDP 0Q*|-P$!u,P m Wh-P  P\h 0d/ P0 P P-P(l I ЍA/Ph*LE-@M`P BAA) 7ǟ/uP q7 R  p||7lW/  QXW @BဠY@'ύ000P@@@U8V ~ BK0@(1,A P< nSw,  Q \@.0NP S@1]J/ P ̍Q /SPPw / 5^噷PPeN۷ ;PP[En_?!b\P3M: zOۅPP@SO wz%ʅPP/x Q 4T/1 @ !居PPh  ᦅPP nO \ᕅPPፅPPnO\Q(,!J/ ^̍:sPPh s<o%^PP 3S @QQ1RPP~aPP "?6P4P eO!~PPA P< B  2 P1QPP1 S4PPqO,mPPg  0MPP\`4Q Ϡ !1z4Q!RPPK "oPP<ORPP5RPP,"P2P PP" Q 2   "2 嬴P R"` 206!J4Q p !,04QߍE/6GIST-]yPp@-`PM(( $2$Ÿ/ R 2R  1A/@PPʼ 1Q/PPAUPP^\ x% 1t/ Pl!80P% \P! P1 P D P 8P ,!0P P 1 P , 808P RŇ<P <, d0<P\ H 0D/xT 000Ѝp@/gGISTk  $(V^_@-@PM00 ,0,/@ LЍ@/0O-AM M TPp0@dL 0S  6Ɵ/ Q 6V/X 6x/[X `6PƟ/TP ,<6(V/ T&0rPPx   PgE  P W8 u ᡘPXEP W8g ᓘPJlEP 0W80Y ᅘP<8EwP W8K wP.EiP W8= iP D[P W8/ [PDMPDGP W8 GPW ,$<4P8  8 {P8 V ,#O?P<  < dPQ?0 <`T4P@S@^pL@@P'P y @D$D HĝHy Pĝ0\+ `(P  #PP0 YPPPĝ  vWP >)P1 d"6,4)P@"-W ᛗ?PL"P8P @ +,,Ÿ("(0@+0STĝPc\/P BP@Dth 1P\1L/<P  <, 1<80P+  P' P# 0P 䠟 P P 0P P P8  8, P08긐  T 0 ЍۍO/D*pD0  $(.GIST^kn8 P EE-`SDM0p<0Pp 2Rx2y|Ÿ/p2P Uw @ ]("P Ud @ JAP UQ @ 7P U> @ $PP U+ @ 1P U @ m@,<@0 @[@P V@d@ht@lx`0< @ q@P <P<DЍE/   $(EO-͟M p @RB  =]/Z =P  | =|͟/ P dR < X T=8]/h@hh0W Q9 R6 =_ ^  <\/ P  <̟/h l <l\/ RH <H̟/ l\ ူ>PPO倲 (M6PP `PG `+PP`n ;6PP P 8P ,+G[xp;ύP0P`@TS L+ pWXW+[^#  ≄PPkOz }_|oB1PPύ0S 2t02%PP O P k P 0 ,:ɟ/2 NX" ̍/0!N 8#$Ġ#,  -RBPPT "X PR02 `CboPPCX= kO}  8ύP*ύP| XP (8PPP( .ȟ P x(l0XP⡃P⛃(`P(X P  2S R `$``PPO`W R$5PP  PPE 5PP   P VP &1wBT/W0V/PPPXPU0V/P20 0B<$P V 0P @@<PPsh&VmXO`̒@Pb`p"UT %  0 R0S R%UC % @ PP;TT TT TT+ ᱔h5ύ RT% R RR*,%$UP BR%P\R * ,$4ύP $1 $/2PPp  N ttύoO~P0S 42|~Po 'N p8 2 S$ 3 ß/<ύ-"4C8#$#, Ď< -=- A7'Br@~P " @ 2~P2 )~PwN c/(`~Pa28b ~PXob/ r/$rύ}P; R 12"}P/ed PP\! Q"P؁ `1ύ APL!(/Qh0 0h0 0Q PPPP ⴁPߍO/l<@GSM5GIST8S<& `LC]'|-ZVp8X.A- M?RPiD@8 0D Cp` @B`@PT   @@@0d@S0 (1(/ P;0WS HS S( DS0MS SS+mS dS hS# sS wS 0` 0`s' > <0s'``pWp QpЍA/: Q-M0PЍ/xp@-RXM@P <0h` \00^髣 <夣 <R@t0 pClࠁ/PT0 TPXЍp@/  aO-PM<p y<yy`yP@  0pP\@yQ 0T0 X pPM@ yQ 0T0  pP>@ <y`Q 0T0 pwP/@ <yQ 0 0T0 peP@T p |0|/TU @@ס0T DЍO/$,@-0@  Q<808/P r3@/x -G-MPy0ppGP0P,3 ƕ,@ἡ0@ T @#P0  4n®\`F +~0  g pp0XX @ P`p@(, P{ލGЍ/P  $A-BM @ @DA~Pp+`K 5 8ĝ0  BލA/@-4 @ <Q !0@P01@/0@-0 M @1/P \ `1XQ/Q 0@ <1,/( R $(,^,$0S$P>VU ի`PPϫPPɫ0QP X d0 0 R00@\\ 0L0@ 0  Ѝ0@/x  , H p@-`P 0/@T 0R  0P/Pl  p 0PC\$HH |UTp@/x ?laV  L d0@-PP M 0R  0/P Q 0S PPP  @@$ s7  0CQ00 , Ѝ0@/?laVx  H `@-@PM 0 ^ /0S 0 l| x0d/D 0L0^HH 046Ѝ@/ x?laV   `@-@M8 5 ! 0 0 46Ѝ@/O-QM L 2Ÿ/X@D0p03Q0ST` \2Pb/X R pW 0 ,2Ÿ/p!2p `Ps @ pT !1@PZ  7 ,`0 0P4@ _O<0@@DDH⾟p00H p pp p$p4$]P8T(p<,p 0p4@pDpLpPpީHpvv 崴`թө H0 |$0x$ 06 X` X8 0ЍO/x2 *4 5 4: (Q?laV~ O-MM3NpP`P P ۩P@ n`S;  z UH 0  `4"@P P P ᨩ2P" U  x2xB/7S X"|ᝪPx@ު=4P 84P P!^P .PX.@P  P&!E P`!T<P  @@ +CnZ `F>+0PS PE+M0 `P_P& ZP !@ PP 0P P P EP  @P @ߍۍO/0elx34@-PMp`@ R 3S 4P $ L @TЍ@/@E-$MPp`PH0 xp@@@4@D 0` @`PP6 06 P $ЍE/;G-`p(M@`ϨPᖨʨPᑨ PPH0 ldEPPP0 0 p`@ 0q (ЍG/;(A-`M\1MS@HH D3Dß/T* 4\pP  #CK^NΆ PVN@  0 4 C+T P K~ P @0] ; pC.K@M  Pv  @0f\ @ D0Z D0U@\{ 0Y0]S p S@ h!SdAL0T!KD!@PP &`☨6T  0@P@*0 TT TT \@P0 D S @0 J@\FƖp 0 pGT+*@ߍۍA/xZ d;V543A-0M @p ,a,1, ((/P  + 0  4\PP  &`@fP` #`P + 0d  K O 0@ c4`ۍA/dx& L\l50@- MP R  @O Ѝ0@/O-ğMtP@ İR3s/[ 3ß/T 1/S  3|s/pP h#Nt0L#E  0Q(#C`Q`{1@w1@T@P  R V"!$pV^ P"3SS /S S tR1P 00tI100"x$"P 91P 41P `t +pPa@ 0 R.!  P"p!^XQ Tx  ⻣ <!0|(@`V6 FTD( P R@p@孤Be>@ff/@ Fn (P''knM04~$$N@PPphg-e0 tk>k΍@P ` $@$gT uP` G4P F MW04+ MP7`@SP@@`oP & `40+ [Q,&d&$P HƟ@4+ 86t@Ph(@$30BPSP`@?P@9P%nPP\ 5E/P\FT6'}]P8 (PT$`p4%P %R< ^ P@i. `T Pͣp`i @OP ] 'P,($巭P e V04%峭P |? <^៣,&  'P#_NT @ ^ 0@4%V>inP P  ╣@f. `[~T p x@e2@姣F  s'P"Zl͍P%~4fR ` @& 04oP M02@LuT p@U@epT = < !@0!!^P?`VM 3FTP"qNALAJ! !_p;'V \;i`@! ءt!Fp@'V@@T$<0 !@! !  @A4+0 &@ @ݍG/P8 x:CtTX[a"CXu;54PhHOd@-$Q\M@@p`!1TPPT  R0/@U 0/ p(P@/P t t0l@/PIP@@@ኢ+@+\Ѝ@/h4xA-^MK>AnC @P p FT K + 4#+RP 0A$ P@`$ZFT\1S  4DPWA~ @ #?X \@` P`+0\^   P 0#|Cx#0 \aV   |@k`aA jI?@@p43W04 Y4@ 0@p+0"+ x2@PP7S\ Sx `P\ FT~\Q   0{@vP1\` P?0!^F\1S   D@?@\P9 @hhA+ `0@I@P.A@!@PP`FP! 7S PA+ 0@]@@@@4T] e@ _>@@``PPP ܟ\ I$@X@^ލA/(dHp4X[3^=<;5A-0PQBM`DQ$ @MB.@"UD04 P$PD@;!.R$p4.QAT pW 0\47P h#@/PᎠ@P@Р/*P DP ß!0@@PB PU@T T  ""< @@0l"hB l K T  g @DP+L0"/QA. D4$@C/QX@$ ;.\1S Q0!R-0 * (A΍ A΍0PPDTH Q 0  ĝ\J@^0 40 @TP@ P  \ 3 3 P 8@t 2@   @  QrXBލA/X5<(DO-5ddUU"H` `P VU (!$(0\\   3 UU U u3 PPU0PC\$\\ <U Ѝ@/x(5 4d35Tdp@-M 2R  1/@<PP0`8<ǻ8Q8Ѹ@&PR0@Tx 1t/h!L0^8PP! @3V `@$!17P@  VV V$0 $0 P   0 VT@AP$_` T{Ѝp@/xJ(5Z] 445Tdp@-M 1R B 1/@<PP0`8<-8Q87@ጘPS▧@T@F @18/(!0^!N %V`@ 1P0 PL@|P  K 0 V|`0@C\$LL TЍp@/x(5 5O6d@3 SDQH#P  /0@-@PPM 0 ^ /Ul| x0 \ \/@Ô \0]D04/@0@3@Ѝ0@/qweiVrP0@-PP@M@ <0< 4 ^ ,/M?@Ѝ0@/weiV0@-PP@M< 808 0 ^ (/PAЍ0@/weiV@-@P88 40 , ^ $/P@/weiV0@-PP@M xx0x p ^ h/TDT P0 \ 4/0SЍ0@/weiV0@-@PPM 0 ^ /@ ^Tdd0X/ ^,DD00/Ѝ0@/weiVp0@-PP@M xx0x p ^ h/TDT P0 \ 4/0SjЍ0@/weiV0@-@PPM 0 ^ /@ ^Tdd0X/ ^,DD00/8Ѝ0@/weiVp0@-@PPM @@0@ 8 ^ 0/ cЍ0@/weiV@-PPM` 0R  0/PPLQ' o=cP1pS P T!RA @T P L\A @T P Ѝ@/weiVkA-`PM t1R ll h1h/TAT8!D1PTC TPPTqQPobT1qP PU P P', 0`@P v PPT!\ @@T0 T!@H, 0PЍA/weiVINZbA-`PM t1R ll h1h/LAT8!D1PLC LPPLqQP+owbL1qP PU @P P', 0@P   PPL!\ @@L0 L!@H, 0cPЍA/weiV&+7?0@-@PPM dd0d \ ^ T/P(P0 0Ѝ0@/weiVp@-PP 0R  0/,P` (8`P$P,܃,@(n$P,$p@/weiVp@-@PPMt0t p h ^ ``/T P, <0`Pў Ѝp@/weiV4p@-PP@`l0ll  ` ^ X/T8D @04/0 p@/weiV<p@-@R`Pl0 hh \ X/ 0P0 00p@/0@- M0@P 00(0P$0P 0 Ѝ0@/0@-@PPM @@0 4 ^ ,/!aЍ0@/weiV0@-@PPM @@0@ 8 ^ 0/8aЍ0@/weiVp@-PP`@Mp0p l d ^ \/ `0b80 RR Ѝp@/weiVA-@PMp`  1/@'W0S!  Q PPP0XbPP P  0/ROR RPCT P  BR@R(K :RЍA/$A-@Pp`ll h0h/@ 0PP0S PCTA/tO-pPM0夢娂 3R  3ß/@ R=3C/ `@LPlBhB ' 0a$@PPh!@T^] ,PZ TlWPPP9B0l  P 2@P@ Tv"Rs ,Qp 0lRUl  @Pf X OP O,峲 P "l0 M@PUB VPT <T:UO2S3 X  P  @P%_ ᫓X P ⢓0P P0 P s@P P @_P ^ⳒPlQhP Q ؒP ߍO/weiV`-M $(, Ѝ/O-PPM0䰝쀝p 5R  5ş/@ R5E/.Yl| x5dş/XD\ X5 ᬒW $@PPUu b@C8T#,Pc `ፒὑW P $ₒᲑV C`wჱ,@0TS\G 0^D ʑPW ÑPP @TS_00 p  00"!@PP0A P0A@!P@PQ0!l`QT T ထPGW yP@`PsP $P8lP3P 0S0P S [0 R00  S <| x04/PyOЍO/weiV`pЉ0IO-}M @LPp` $f 0  @ K0@P  P ŐY% P! ὐ0PP | TT l TT \0TT ސP Y אP @}ߍO/0I@-@P 0 ^ /@ \dpp0d/0S ,8^H D00/g@@/weiVp0@-@PPM hh0h ` ^ X/@ ^,800/_Ѝ0@/weiVp0@-@PPM ll0l d ^ \/U8H D08/0SPЍ0@/weiV0@-@PPM 0 ^ /@ ^0x|/0 ^ll0PT/ PL,H0,/0ℯЍ0@/weiV}p~ 0@-@PMP 0R  0/@P  0/(Q $P,m~,≯(\(ῦ,, R \0R 8 H04/$P,yЍ0@/weiVijpDSND$O-P$M`pH H2R <<<2<Ÿ/@P # 2B/Q  1Q/DP F@PgD L@PT@X  0 @@P O H*D $H#P0H3 @P20 P @ TT"tD Hs`Hc`凕p(P<@P   0@P S@P } DĝH#0H3$ЍO/weiV/p1` 0@-@PMP 0R n 0/U P x |0p/<0Q<HXX <DÔ ARD< 44 @Ѝ0@/weiV\p@-L3Ms@ T L5Lş/@P ( (5 ş/DQ  5ğ/H 4ğ/H3 4ğ/H 4ğ/ RQ!^0SP-\$P ,Q|$@| R ÙDQD0^00S,P,(\(ب4#R8Q ^Cބ1SڄPEք\F҄!RG΄LQ`7E ^00L0S  3Ÿ/L  P 0 0L0S  2Ÿ/L  xR, <2PLPU`VLOϠ 2LQT1S`7E Q00T R  1/T!0^ 0 0TP d 1\/T 00  \Q, 1P{TPU`V,T 0mTQPQ8*4(N⚄<0S0<0x q@#R \ 0T/ 4 0 W/0;Ѝp@/<Pt57G,INYTZ[p@-`P 0/@T 0R  0P/<P< D^t 0p/DPADS< P0BS<0,TT U p@Ip@/weiV @-@PHH D0 < ^ 4/ 0>Y@/weiVԒ-M,Ѝ/p@-`PPpp l1l/@T P1R 4D @10/U@0H1P 1/@3CQ0@0/<PU@/ (0ENOZ@-@P<< 80 0 ^ (/E @/ (0ENOZ@-@P88 40 , ^ $/@/ (0ENOZ@-@P88 40 , ^ $/@/ (0ENOZ0@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/(0 ENOZ 0@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/(0 ENOZ 0@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/(0 ENOZ 0@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/(0ENOZ@-@P88 40 , ^ $/d@/u(0ENOZ@-@P88 40 , ^ $/h@/}(0ENOZ@-@P88 40 , ^ $/l@/(0ENOZ@-@P88 40 , ^ $/\@/(0ENOZ@-@P88 40 , ^ $/`@/(0ENOZ@-@P88 40 , ^ $/p@/(0ENOZ@-@P88 40 , ^ $/t@/(0ENOZ0@-PP@M< 808 0 ^ (/tEЍ0@/(0ENOZ@-@P88 40 , ^ $/x@/(0ENOZ0@-PP@M< 808 0 ^ (/xEЍ0@/(0ENOZ0@-PP@M< 808 0 ^ (/|EЍ0@/(0ENOZ@-@P88 40 , ^ $/|@/ (0ENOZ0@-PP@M< 808 0 ^ (/h@Ѝ0@/(0ENOZ@-@P88 40 , ^ $/h@/(0ENOZ0@-PP@M< 808 0 ^ (/EЍ0@/(0ENOZ@-@P88 40 , ^ $/@/(0ENOZ0@-PP@M< 808 0 ^ (/EЍ0@/(0ENOZ@-@P88 40 , ^ $/@/(0ENOZ@-@P88 40 , ^ $/p@/(0ENOZ@-@P88 40 , ^ $/0@/(0ENOZ0@-PP@MD @0@ 8 ^ 0/TNEЍ0@/(0ENOZ@-@P88 40 , ^ $/@/$(0ENOZ0@-PP@M< 808 0 ^ (/EЍ0@/(0+ENOZ@-@P88 40 , ^ $/@/2(0ENOZ0@-PP@M< 808 0 ^ (/EЍ0@/(0VENOZ@-@P88 40 , ^ $/@/](0ENOZ0@-PP@M ||0| t ^ l/THX T0 \ 8/$0S0Ѝ0@/(0ENOZ0@-PP@M ||0| t ^ l/THX T0 \ 8/40S0Ѝ0@/(rgmZ0@-PP@M< 808 0 ^ (/L@Ѝ0@/( rgmZ@-@P88 40 , ^ $/L@/(rgmZ0@-PP@M< 808 0 ^ (/P@Ѝ0@/(rgmZ@-@P88 40 , ^ $/P@/(rgmZ0@-PP@M \\0\ T ^ L/T(8 40(/X@Ѝ0@/(rgmZ@-@P88 40 , ^ $/X@/(rgmZ@-@P88 40 , ^ $/T@/(rgmZ@-@P@@ <0 4 ^ ,/t@/(0ENOZ//6S6/@-@P88 40 , ^ $/@/m (0ENOZ0@-PP@M< 808 0 ^ (/EЍ0@/(0 ENOZ0@-PP@M< 808 0 ^ (/EЍ0@/(0 ENOZ0@-PP@M< 808 0 ^ (/EЍ0@/(0 ENOZ@-@P88 40 , ^ $/ @/ (0ENOZ0@-@PPM 0 ^ /t0S|| 0*T\` `0P/0L\ << V0Ѝ0@/(0 ENOZ  $p@-@P`P0  ^ /x0S|| 0X\` `0P/0L\$<< fV0ٹp@/0( ENOZ  $0@-@PMP L2R DD @2@Ÿ/P  "0S  2/t  tUY pļ0S 1/t8  R\| p1X/t8t0>0S D 41/t Rt" R 0/t 7Rt0 Q| 0x/t 8P 0L/0AS0XX 5Ѝ0@/ENOZ(< 0> H K N O R S V Y X[ $p@-@P`P0  ^ /0S 0|0\\h \/| w$0AS44 Hp@/0( ENOZ  $p@-@P`P0  ^ /0S 0Ǹ|0\\h \/| jw$0AS+0 H鯸p@/0( ENOZ $p@-@P`P0  ^ /0S 0劸0\`l `/ E | ,w$0AS44 Hqp@/0( ENOZ  $p@-@P`P0  ^ /0S 0K|0\\h \/| >v$0AS44 H3p@/0( ENOZ  $p@-@P`P0  ^ /0S 0 |0\\h \/| v$0AS44 Hp@/0( ENOZ  $p@-@P`P0  ^ /0S 0Ϸ|0\\h \/| rv$0AS44 H鷷p@/0(t ENOZv x $p@-@PP` 0R  0/P 0S dl l0\/x0VA0 00Px0(( vp@/ENOZ(0b g $p@-@PP` 0R  0/P R0S dp p0`/t0VA0 00Pt0,, 7p@/ENOZ(S 0U Z $0@-@PMP 0R  0/U P  0/Q| 0S `t t0\/ AP88 Ѝ0@/ENOZ(   P 0@-@PMP 1R  1/U 0/P 0S  0/p R R T l0P/0 CRpP << Ѝ0@/ENOZ(e0fkn$0@-@PM 0 ^ P/|0S| 0mP\U `0T/0L\(<< 0PXЍ0@/V(0ENOZZ$0@-@PPM 0 ^ /t0S|| 02T\` `0P/0L\ << dQ0Ѝ0@/(0KENOZMO$p@-@PP `1R XX T1T/$`kP$00!EP-\|DPPP*<PPP"4Pt$PP4@P5S :uP P$@TpXPH` \0/PP88 p@/rgmZ(w y $ X dp@-@PP 1R  0/U P  0`/$`P Q| 0x/0^Hl `0D/fP@@ _@p@/rgmZ($dxRp@-C>@X ` P `P , P$0 00`p@/(80@-@PPM0  ^ /0S 00\lx l/ P0@\$<< 0Ѝ0@/0(b ENOZd f $0@-@PPM0  ^ /0S 0մ0\lx l/ dvP0@\$<< 0庴Ѝ0@/0(yENOZ{}$0-A-鐀MM`pP@ʍ:@D8P4  0 r40,, @ @ЍڍAЍ/  -@-pMMP`U@ʍ:@D4P0  0 r00(( P@~Ѝڍ@Ѝ/ O-P!M Mp 1R xx t1t/x0 N   0PA@@D^+P1 }0  P[*n PA.0@C+PNn+` \T 0 H `Pt[0LЍۍO/ENOZ( 0`a0-A-錀MM`pP@ʍ:@D8P4  0 q00$ P@ЍڍAЍ/  -@-pMMP`@ʍ:@D4P0  0 q00(( P@Ѝڍ@Ѝ/0  p@-@PP 1R  0/P y`V  0/&`0R0U0S0`6 r3UP &Rпf0CQ,, Lp@/ENOZ( 0  $p@-PP` 0R  0/P  0@/Q 0S dx x0`/@Fⅿ@ @R 44 p@/ENOZ(0  $O-@M ETP x1R pp l1l/$ HP8DD!Բ`P `쐄p P t P h1lS1P`5`5 V$ /lQh! DhlQp| DhlQ| pPq| Lq P (<< 吲 [ЍO/rgmZ(D@-`P MP 0R  0/UP Up UGppG p C  hP @(88 I TP Ѝ@/rgmZ(bʚ;w:@-@P\ X0X P ^ H/ *0SQW @/(rgmZ0@-@PM (2R   2Ÿ/0PQ0!qP^ 0 S$ Rd R  1Q/d R$ `0S Xl l1T/P`&R0lQ , (1/ PlP R 0hQ  0/ PhPPt 0p/P 00@S00<pp U   Ѝ0@/OImZ(",L$l')G-M@`Ppp% P0P0L) D@ REPp T  Ws*Xp*,!1 躱Pg Q!:0S || |1|A/ŕ< \  DT P1DA/Q55 @^  1/5@0%R55 <P  0@/<H @RUH0DPD5EHPp g@LP (PP ް!܍G/c($P|$@-<@M`pUH0PW !S 4 0Ѝ@1@TЍ@/0@-@PM$P 0 x ^ p/PT @P吰P00 兰Ѝ0@/(rgmZDO-@ M?CT 0R  0/$P Z`pP[h ^\L:P  P P  Z|l:P$88 3 Z ЍO/rgmZ(-6MS⋺Ѝ/O-MMQ 0 5ş/X 5E/@0 @! $ @+= $0JD`P@ 0 ~JZp{x 0` `P@ ` PyP @ ^| [yp0C\uN1n.`z PL``$`$P] xZp傮΍P ~@pp @ 6 0  PPP PP)@P9 T  0PPP PP@P) C^PE+|`3T T T#TL#0<T4#0 T 0@@D +^0"@>oyP  Uv 1x城Q   +R 00ww ʝ 0+p H2΍nJZ`w P0P` PUP@0SP^Pʝ\P+RP PPQPAPGxpPap5y W^PL !NyPdNnU` wQpW :S`:0^d:0˝\h:0+Rl:0 Pp:0rw+- okw+͍  㴙ߍۍO/( + : :\( Tt<} @- @R44404/P/fK@/(-@- @R0/0S0 j BQ `\d `0`/t 0Rt0,L (0(/t t@/(    @-@P 0 ^ /0S p0!l\ h0PT/00CS00  @/ 0(ENOZ  $@- @R0/ n0|S h0p/ttΠP<8H (0,/t0)t @P([  _ b @-@P 0 ^ /0S p0尭\ d0PT/00CS,, 陭@/N 0(ENOZR $p@-@0 \t01`P/t0S| h0P /t UtP^ 0044/t0t0>p@/ ( A- MP , lU 3R  3 ß/t@p>p0S% S( S}t@ 0t `Vt@>P  2b/>P>P^[t 0t 4Ÿ 0S@>P  2a/`>P>Pt  @>P  1/`>P>Pt `V@r>P  81a/`e>P>P@Y>`P   0 (0: P  0c>P(  0% P X 0 ЍA/ENOZ(008`0@-M@ kTP 0 ^ / R0/ 00S l0P\/t t@PH D ;Ѝ0@/(0ENOZ0@-@P M 0R  0/P PU  0/t 00t d@P PH\\  LP44  Ѝ0@/ENOZ(n0su$A-PPM@ x1R pp l1l/ RHTT1H/\PE t B !@P!$` p<  =P  0"  <  =@Tx 0t/t0@t1=PO=P!R%ЍA/ENOZ( 0  $\ @-@| 0Stt0c Q`0TTX/  t00CS$$ K@/(G I $0@-$M@ iT 0R  0/ 0{P  PU  0/Pu?PPll   0@S 0@@ $Ѝ0@/\ENOZ( 0   $p@-`P 0R  0/$PIP ժ4@$@TPdxx Ǫ3PD`` P<< p@/rgmZ($dD@-0$M@` 0 R0/t@`0  ,@ pR P  @5`0  P ^Ừ$Ѝ@/t(xop@-,M@h0` ǪP`P @ 6 0  PPᒪЍp@/ᄠ@-M0@` p 0 00庵PP/ P &! PP% ^PP ᆶ0⇽r {s(0S $@(   @(0   Q  R  P Ѝ@/@- H%(^7 JNB. P-J>Pĝ\ ^8 43B/t tM05@P wˍ KJ @t@3-@t ;$P I  x2OP P? tM>TM tMNE TM.| 1ftZ-4M @0  @pM> 0庄P$ I΍  h1W  Q W R P810 |0"ĝ\ KbQK.0CP 0 *ЍۍE/ENOZ(`0bbutScgi|,DhT"$p@-0MS@P D |aUD ?P:8! $000|0Ѝp@/(zG-@PM 1R  1/X 1Q/Z 1q/P`t!Y D X1</P!P 01pP 0`a R`P  /PP`P V 0`{P|p^ 00PV` 0`  <0BPLPD UЍG/ENOZ(0$0@-0P s 3Q R@Md0ddd/%R &YPP C(0$ Ѝ0@/(#$p@-PPM 2Ÿ/@T 2R  2b/``p | 2xR/Q Pp l2LŸ/ PP`2 00@T0@  "ҥ\ R  2/\`@AT\h@TW 0 S! R00 d R h 1d/d R!`Q (d d1$/0`0#R00 l R ( $1/l R  h0S  0/ h PT 0P/0 0BS00$ ^T `Ѝp@/(DOImZX 8Tp@-@P 0R  0/P| &0S `l l0\/p P Wd0CQ,,  @/ENOZ(0$@-@P 0R  0/P 0S dp p0`/l P V d0CQ,, Τ@/ENOZ(0$@-@P 0R  0/P 0S dp p0`/h P VHd0CQ,, @/ENOZ(0$@-@P 0R  0/P m0S dp p0`/d P V d0CQ_( R@/ENOZ(0$@-@P 0R  0/P| 00S `l l0\/` P Vc0CQ,, @/ENOZ(0$@-@P 0R  0/P 0S dp p0`/\ P U c0CQ,, أ@/ENOZ(0$0@- PRM0 /40P @/00^00ll P00 $@H$.0Ѝ0@/(0@-@PM 0/@T 0R  0P/$PPXpp lPAPhP,LL aUЍ0@Ѝ0@/(@rgmZD@-@QMP 82R 00 ,2,Ÿ/U Q  2a/pW  1/$pP!0^x! R \ 1Xa/$P 0 0 8\ H D1a/ 8 R$0$0 40S  1/$4`$` `0`C` BQp ТPP ȢV \ (x t0$/Ѝ@/ENOZ(0rgmZXl$DA-PQM` 2R  2Ÿ/V lQ P` \2LB/$P44"wpWp"o0S  2/ P   1A/(Q  1|q/^ T 1P/@㱰{ P  @(@0 @PP@P, 0S,0 0/8 R$P804P 0$8P`EA\< Pxx ЍA/ENOZ(Z0rgmZ[]^_`aT{$DE-PP M`p, 1R  1/Z P  1A/|!1@PV (,0d!PT10 1A    0 `V0` \`X 0S``V\0 \ d0S@d`@d@l P@lh@ l@00CQ08dd `V@ _ ЍE/rgmZ(OImZpG- MP  _U |3R  ppp3pß/  X3{P,<<#P`@FT@#0X"  R  2Ÿ/\P " 2``@FPX"PxbH XpbC Z0 @pWpL,"ؠ0S 0 2/phY.`!1``Pa0CP@ t!屠 @  1` 嫋\ eX  !T1@!V`5 @T@, P  0/t@V@t @ 0S6t0@ t1 0 CQ(T ^T4 ЍG/@ENOZ(H 0L O R U $2Ja j v } " 0@-@PM 0R  0/P3 %PU 3 0/P 0@S 08LL  UЍ0@#Ѝ0@/ENOZ( 0 $p@-@P 0R  0/P PU  0`/t 6 t0 \P :#`P`P0 CQ0HH Up@np@/ENOZ( 0  $0@-@PPM @@0@ 8 ^ 0/ Ѝ0@/(0ENOZ0@-@PMP 1R   1/P s^  0/!0R0{{Pl WPԌ0C\<\\ K AP@@ BЍ0@/ENOZ(0 $@-EMp`0SPW IP P VD _P@TЍ@/A-`RPp 0 \ @/0p I@P0 ` Dp ```S40 0 0@A/L(kmyftNO-`Mp!1 PP`e @ $` , p@@ @4@8@<@@@D@H@p ]  `P?0 L P0  `P1@  y`P(    0`P@ / P  X\```d`h`l`0`@0P H.0I ЍO/( e3:rgmZQp@- @M0S0xxx!LPQ XX X1X/   0Q :00PLUP  !-P6|P`! \P PP  \U1 0 @ 0  }P 0C\4( Ѝp@/(.0lN0@-@PMP 0R  0/P Ν0S | 0x/ P ]*U]ҁ 0BS00 Ѝ0@/ENOZ(J0LQ$0@-@PMP 1R  1/U 0/P m 0/0Q s R d| |0`/P}0 CP<< YЍ0@/ENOZ(>0?(@BE$E-@P,M`  3R 3ß/ R3s/ 0 pP 0S d#`sPL#@sW_0(#(00(AQZ d RW x T t Q"k$ ⪍PP "apPU6P qAp"0pN)Pz00d $ 0嚻PPoZ Dh0sA d  P 0 ^ !0!0&Z$ \QL Q!0P寶$\ `0密PP70P9 PP!傜40!D,,!0嗶df[ |0 0剶P Qh l0`/tB.t  Wpd^,ЍE/ENOZ(0X#l8Pp p@-@PP` 1R  0/P ^  0/ 0S 0t  PLQ@``  0@S 0@@ p@/ENOZ(v0wxz{$@-pQ,M`@LL H1H/T$0 ,1 Q/P D0@YڮP  ̳P  0bS ^P~P @[P |ZP /Z 0 b P*DԚ К,Ѝ@/(#$ܬ,p@-PP@`d0dd  X ^ P/T0< 80,/ p@{0(~ENOZE-PPBM M@ 2R  2Ÿ/T 1a/P!%pW  1吁/0`;P Cy  Q !;@UFQ 1M @B+0 ;p ᇕP   P a\$@D@@D p0 u 0BS PP ,ЍۍE/ENOZ(0 $p@-`PBMM@ 1R  1/T 1Q/Ph3x!^ L3 \1H/&0R0 R , (1 Q/FQ 1@F Q ? &0@C+0 ˍP )PP < l0 AP!PP 5(Ѝۍp@/ENOZ(*0+(2\6;=?$0@-@PMP 0R  0/P ^ p| |0l/p%0R0WYWXLP00 Ѝ0@/ENOZ(i0ko$0@-@PMP 0R  0/P ę^ p| |0l/`%0R0VbYVXLP00 Ѝ0@/ENOZ(]0_c$0@-@PMP 0R  0/P ^ x 0t/\%0R0U YU dX0CQ00 bЍ0@/ENOZ(Q0SW$0@-@PMP 0R  0/P <^ x 0t/l%0R0V XV X0CQ00 Ѝ0@/ENOZ(E0GK$0@-@PMP 0R  0/P ^ x 0t/h%0R0VXVW0CQ00 ؘЍ0@/ENOZ(90;?$0@-@PMP 0R  0/P ^ x 0t/d%0R0VOXVW0CQ00 Ѝ0@/ENOZ(-0/3$A-PPMp`  0R 0/P hP 0BS0p \PtP @ᚂ0  'P SЍA/ENOZ (0  2 0 0 0p@-PPM 1R  1/t@Y0Q`ll! R DP P1@/Qt : t03!y.a`V%t ' @   ) +P ;0 ^t 0Q` Q:%0CP@@ Ѝp@/ENOZ(m 0w  `T $@-@PM 0 ^ /t,Ƞl0 d Pt0gpP t Ѝ@XЍ@/, (0ENOZ@-@P 0R  0/pP! 0Q| c R `l l0\/0tC)Pt  88 L@@/ENOZ(0$O-5MύPpUD@ R  4ğ/z?? Q$P p| |4lğ/P R @0 0@@@1@P 0C^#\z#0[#Up R @@Q \t#ǖ]['0P' @\ QP0s l\P㌀]   8P|@Z:Z&:d%R N? ͍]PJWP@2S Z:LQ@H,"uz04"G r@T8 t 0 S3ύ 0嘕P'DO``P#OD` ^PT!ExP z0p!0`CP; P!06t@" @T$ 1/t| <t0T@ @R zύ 0| T @BQ,D ߍO/ENOZ(0$$Pl :%O-@PM X5R PP L5Lş/x3 [ R5ş/Y X 4ğ/0P$ R  4ğ/X`pP $P! V`|PYU00p` \` R R P WpPvlQ  | 3> Q` 0S 偩 , @3)   QV`:@ 3! 00Q ß!2  0Q0| 2  "m0P 0  Sh" 2_P "  p RY pW " D2HpP 42 0 1ϻŸ 1Ȼ WPQ R`P1 P- (P <  岩P PPQ Up  1圻X! 0啻@ 0去PV 1,` 0P0p 0/t0*t    BQ 0 倔P 0ЍO/ENOZ(/ 02 DT5 E O T Y g q t   $0 E-@P Mp 1R  |1|/ZW  RHTT1HQ/Q00!00S  1/hQ l!| 0 l!h!W |P  0^PP 0PCQ`   RhQlqPLP! LD  ЍE/ENOZ( 0   $ p@-MPP  |4R  ppp4pğ/P H L4DD/,Q , (4d/^  4ß/(0S  3C/%R iQ  3c/^ X 3Tß/5S ,. \3(C/!R{P#\Q "3忹\`Q\` "?㴹`dQh` "/>㩹d`d`Q ͠ƕ\<Ƞ@T%R^-JB 0aPD"4 P(("+\|e^U R`ŕ\VRd5SVNRh%RVRl^V Rpŕ\WR0@1P :Q 4!1UfQ !d1Mf Q H1E f$Q 41 =0$6ET].OwP00 ْ^00| ђQ ` 0\/ @00 $ 0坹Ѝp@/ENOZ(0<Pd8|,O-PP!M M (;R  ;˟/ ؘ0+P *t@T  :ʟ/t0 J| :/ R\  |:/t Rt( T H:$J/t>t&P *::Y ( Y] YjP  9I/tt^x  9tI/t 9Rt0 < )Q N\I XX)DN ΍@!=!-N 0 @@D @BT@(DQ ȟQ0(R@Q(Kt  >0<00Rh 8G/t9t08:x0 0* t'@T@ 3ß/t0 Rtp  3lC/t%t  R#*0\Q (3C/t @5 ^p 2Ÿ/t@0t0@ @ T5SU.'xX^U΅7t( d (&h0嘫P  0S "0ᕖ"0Q 1/t0t$PDD""%R55HQ X 2T/5H0^55D R  1/5D0 ŅŅ%($Ptt!T t@@> ,QtH D1p/,@D,0@C P(!ɏTLЍۍO/ENOZ(>0CDEFH%KNRTb apr|$ 8P <  $E- M$"$P1P   5ş/t@1O#P$kvpMn? `$0 P fO@? 0t$@ I u /rQ<$0 x  $0Ot0I$0$ 0# 0S0#\  3c/ptGPt& Dxx#!$@P B "P 2v/S 0 #pt0"f R aV pU XETU I$ PP 0t"B 0S0X8"\ < 2a/,p| \M`M| VM@DP!J@GT ` 1\/Xŕ U0  00`  wP30S00 l R  0/ZPZP  '0CQ@ ,` B$⍎ߍE/(,<$tW p@-PP R 1R  0/@``P PU  0/,0St 0pP/,L,&P` @R (HH ۍU p@p@/ENOZ(6 : ; > $@-@0PM0c  Q; R  0Ѝ@/&(A-pP`P @1R 88 414/V 1 A/U 0/  s=ҷ@PP'  Pᘀu`P  *PP SPP  |2PP PA/ENOZ(06$wroFA-M 4 K0 @ 1`V R  2Ÿ/pW X  1/ 1啀m? ,P i!0( C/┘P20  c@P,  ^( "z0S  @P ᐇ ?@ 00a  / Ab % QC 00bm@P \ ? /ލA/`wroF(_<ENOZa08p@-MM$I RK$@ ; R$< fR  6Ɵ/INt6 0P@PP&xdQ 0 06Ɵ/@@$ t0@$e Q"t@@-`P$\ 5E/4P:X| x5Tş/D| !JB.ž R 1S TK.` QO`P (@+0$^ĝBK> ^$5(EQ; ŒJnB. "`P0JPDT4^ 4c/ĝt%t 4M@D`P [ˍ -K@v@3=@pP P `$t >PT| M>TM t EN P4| EnM TM΁| ?J$tP$P D֑I t2KN@dĝt%Z-00  0 !Ÿ `M> 0h`P DD妑I> 1@P`@`@ĝ\K.V ^D ,1/t 0t0^ ET(Ng4  @\Q  K Ѝۍp@/DTK΍ޞ4 $Q*AT@ENOZ(0,Dhvt:$G-~MN Inύ0P11 R! R  >~/> Uύ1p? hEM? y_ PP``.,@T T!te8PUP 8/1 R  ?͟/PP^ >͟/t łt`!0NS0` .Z0l-g0]PLH-0p@Tx0 M^  0PP2apWp -1P  =̟/app1 R \ =\L/t0$t PQ@^  D<,0!,AV$,EύU?0tD! .{P= 0`P A<+0`Va eOP wA&tE>0SS S718+?0\ , R  ;ʟ/1  ^x  ;tʟ/t 5t0@!NQ ( tUET*1Q1pP0  p@T90*q PUP *cQ d  :`ɟ/qPP1P $ H:$I/t0t`a AR 8 *8T   9H/0|\@P(0D!Qh)\ H |9Dȟ/  0S  ,9ȟ/t t@!0CP  4)  (0  x@ s Pn` iT'0000V^'0U PVQ h'0U P'0L{ύ0 0P'R`P &nOR P(&A@n` 66t  ^P y?M P Dp @6R<&0UEg ᭈq@PUPDt&Sa0S $ X6 ş/q``Ap]<^p BP&4ApPUfheύ4 `y5S t4 05pt/$pP@%@PUE@ P<@%U@@Q,%0S  5ß/ ,B^,Pt$G,呋t+ ]/⽐P t0[Pt@TC IO$` tAqtE*t0SS S#01*@ 0S0p *Q T  p:Pʟ/t0 @Rt  T3$@<*01@aw0l' 0-X`P * 0= Q )΄0S  9|I/tAPtA @ h)巄K) 0  >@ t9T 0<)@5P$) 0, 9 Iύ p t00΍ pAlAhA@彃PZo  0oPp0 hPt@!pTp^N[IOpN$ nP(U4֥ ᔖPD [ 0la`@@鄃PZ 0oPl 0h``s @oT[ 0la``aPZ 0ioPl0 h``s @oTp%NP` P  opWp8&`V  APxx& l\0S DPHH&ڃ]' R  %΃@T  5|ş/``YpW@ 5ЍE/yftN(D EP l   G-~MpP L2R  @@@2@Ÿ/  R$$2/sL| ?  Pg `^; 6S8 P P 1| ~?| w?넀P| l?_O\K  F0@Ɩ/!@R T&~/"P  1 P 5| 0 0ŃD.?P吠ZP>~ߍG/yftN(K L E-yM$`V 8R 8ȟ/ @Qdll(G PU DL L8<ȟ/ 00 t  $@@U Q ^ D  PLL \0Sp F/@ ? 0 'Reύ PU 07P    7F/!R  6Ɵ/ r/h@Pq K@61~@P n~@P0p./RH #I(0S $A( @  @1(0qAAq~P}Pn}Po#}@PP\% R@x t58ş/uh0C^DD%o؋ْsi >j@PxVG!0 @@oPkKIPgeOkImOi !~PPX!]~^z塠̍0)!rJI@HT?L! 1PlA@! P PQPP P1@@ QGUGPAQ(0S P$P( P  P1(pQQQQ\jPs iQug!Rqy^qATniyQUoq11 \qyPnWyr݉TjP F F?@v/ ? e "0 %Q  Uu/P($P@ @ 8P P@1T ( T (| &= P!t@Z-@  1@0@` ( 0[@P P  *1Sv+wr@ PP AP4 ;~T$~yߍE/yftN( H |  ENOZ0 89;(; 0@-@P$M T1R L D1D/ ŞP> $!0    0) 00 0VP(PP) \ } 0S | 0t/  P 0CQ,LL }$Ѝ0@$Ѝ0@/yftN(  ,H |  O-MO@ [<0PU Rʟ : / :ύ@  :ύ@ t: P l x \:Tʟ/T: 5Su Qr #NP   *a}p0@S* R )U}\  9ɟ/Pt0  ? LP@T xx)2}p0CQt #PpNP<@T@)}Q  8H/\ 0R0 #Pt""Po@@0C\Pt(|T P @0P(cp @Rt  p#P}o`Db@bF`P7}OF MP\%4|ᶝ @ETpWp p$% |`V T 5ğ/p`@@8h@| : P* /P$8 ⚻8"D| :E8TŅ8@82@8"%8P8Y\$ 08Bp|`l1W:`NPA #{Z NZD@D<"0 ```@kPE}ocE P,#{*xrP YL# 0`pWp4"{@T  2Ÿ/`gO `I0 CQpPt"q{W^ /\P\8 88 E@P0 P\!U{Q @ 1/`80p CR 2 |!<{-@T@\t!4{^ @ X1(/`8BP@E8ŕ@82@ 8BP` {88B-E@TS CrO,P 5@f@ f c#E{ߍO/c44 $0/XENOZ0(`   $ ' @$P:d !0@- M@PT @1R 88 414/ U  1Q/00 PzUHw+ U% P z 0^ x 0t/   j 00 AP$LL gz3 Ѝ0@/yftN( P  H |  0@-M@P 8T@ 3R  3ß/ 3U8 dP4 hq1 t@Y jP% T5S0@(6dh0  _P B\ @b0"@@X0"{@0Q|"y \ \x x2XŸ/  ^ H D2Ÿ/ Tt0@t@ ^ 1/t@$t 0U0UU .S*t0 S#PUT x1PA/t0t0 QL 81/@t t P! U @0@T 0/@tVtP%RY PY.RP0@S04tt `yT:Ѝ0@/ENOZ( 08P  " * + / 4 $@-a` P`4 0 B `c BPh xp LR D x|V my`<Ѝ@/ENOZ(0̸$@-pP M R \1R TT P1P/@P$0 ,1 a/`AV0`070PUP wx R  0/PPP Z !gP eV \| x0X/ `0BSH(PP KxU`i Ѝ@/ENOZ(     $O-M4M?}ʍ`. pA,c(c8P⑄B= Lr@D᷄P,⃄ rᬄK@ u,, dP00,k@?mʍ< `,( kP0$0P \PEyP %P$qP.*K}(p 0@ @hP! ቋAJ=@PB P u*wp$P Ř\ `0?m /@p.@B^P, I 6rP+"@  @ 0 @``P`i@P' ̙ T`@ 괹 TYyT>JmP(<A `p 0PPP p`hPP<@$ U7@ UTŘ\@ IM?-0`  /@I]PW@P@̍ PP@Ps @p?P@ CnJ} +`F(p$+ XT 00D(T +  QP 8ȟZ Tx@4 C.`B0@ '@@tZ) Ř\& l?= @JI @(0/ǟ T '0`tT 0@N.B+Տ L'0`@HI=@?P? `?PgTL7K @PK-` ?K:@ (0@ fP@̍@G@  PH &vG 4 $ʈP 5S ?]  /~p`~pGV@,``ۂ q  0PPP pPPg@Pd P%T   0PPP pPPg@PT 0?PA C +JF +B4TT ğ T0$7T x@`$0$Tx` >@C+h$0@v Ř\TQ  /PwK-@PKMPR >6SK@ (!0@ fP?,@F@ PL#uF=@4 WP $P 5S ?]  /~p`~pGV@,`` Ep;  0PPP pPP.g@Pd ,Ÿ T   0PPP pPPg@PT .?PB C +I}  +yTT T0!71T x@`!0h Tx` 0@A+NX!0@v Ř \ T R  /0P00⮖K͍F?PKMPL >,(`,h@T :(P̍(`,gߍڍO/(:\  8Xat0T@-p MP`3@3@| |0 1PP0  PP04 PK ,  0娛 Ѝ@/(8HO-M 0P000p`t P )tIWW pAP&W)T )WF \@z0x)8 a0`)W0 S$ @ <9> 5` &hP @, 4c P%11!l@D@@@ h0$ ARH `m(Ѝۍp@/ENOZ(0h$O-PM@ 0S  3ß/T 3S/ PXll#+md@#`3xPP` p   p7ppppp $S`P,`0@wyff f$f\````d`p`t`x`|``Fh0ΠK/<@ ````````halaa\e`edehelepete|eeedAxEeŅŅee(`ee庺⣺ⶺ⟺>ⲺE> ⚺!f% TeXeeeeeeeeffff%P!`PD!D,%ŅԅeeUUeeЅP.Qʸ 0/0C^  0/ R00T jlP004 bl 8 0ЍO/(>t?D0A,B$u 'ENOZ0$8|0@-@MTP \4R TT P4Pğ/ @Q $4 04 T/^  4ß/ 3b 0S0#lP  3S/0tC@PQt"X#kPPB $XP(dd#k%<R,UU55 @^ ( $3Ÿ/5@0P55P< R  2Ÿ/<05P $ⰪP<"kTPS\h8"kQ L 2/UPP ,P 2/, 0B,0PBP`PDtQQ PTPձ R010/UP0PkBPU(0S (E, R4 1P/,A,P^\ 0|P/ttr 0ASP 00d &kU Ѝ0@BЍ0@/ENOZ(00128:$C<F JSU o{}E-AMMPPp`0 <1R 44 010/V  1A/ &  0jP@@PP  $^ /0P0XP@PU00SP  %@d;T T 0 T@ <WPЍۍE/lbTZjk- M00 Ѝ/0@-@PM  P 0 ^ /Pt`p wj d0 @@r@nP@ < gjT@Ѝ0@/lbTZp@-@PP ` 0 ^ x/ᲨP\LX >jT 0@7PA( 0jp@/lbTZp@-@PP ` 0 ^ x/ဨPLT jP 0l@P$ ip@/lbTZp@-@PP 1R  0/U P  0`/ `BP iQ| 0t/0^H T0@/㵨P, i@p@/lbTZ$P-MЍ/-MO 0PPЍ/%O-CM MPլPX᪫[ P\PᣨPG EPC ' ! 1PP; P ᣫ` @(P (P$Ȑ$B 68` [ `Fᬬ+KPZpp [x@@PXl$0\\ PN <ЍۍO/Q%,   -M( (0PP =0PЍ/%A-pPM R 1R  0/@ ``P hP 0P/PAPݧPp| hUXd 03P 0奏00ЍA/lbTZPA-@PMPp` 0  ^ /0PPPlx h  0!X @PP(  ၧP( zhЍA/lbTZp@-@PP `0  ^ /ΎPǦPHP Sh @MP Fhp@/lbTZP@-PP M@ p 0m `^ /ካ`ᒦPqX` h OPP Pw$ h Ѝ@/lbTZPE-R MP 0S G 0/  I0@@P` p 0M`P 6`P\ P 帠@b 0孎 ЍE/$lbTZ- M0# Ѝ/@-L@0 S8088/T !R@/PT0@-@PPM 0E ^ /Up| x0l/L(\ ^P0</ (0/Ѝ0@/CTSDxD@-@P$$ 0 /$@/T0@-@M0PS  1/T R  0/U 0P  0/T UT  R1P (0S /PЍ0@/PKTSDl0@-@M0PS  0/T R  0/U 0P  0|/T UT  R (00S /PЍ0@/PKTSDl@-@Ptt p0 h ^ `/(@$H^ @04/(0$/@/dKTSD0@-PM0@S t l1l/U TR <H D14/T( $1 /0S004 S SS S S S SS S 01)00000 000@0Ѝ0@/PKTSDd<0@-@M0PS  0/T R p x0l/UH\ X0D/0S0010Ѝ0@/PCKTSDdE<@-l @0dS \0\\/P TT TT T@/P0@-@M0PS  0/T R  0|/UX h0T/P(0,0S/Ѝ0@/PZKTSD[d8p@-PT@0`S @@ <1</U $RT ^  1/V 0/lP%hP!$ R $0S Q( \ (0S P\  (/84p@/PAKTSDBC 0@-@PMP 0R  0/Up| x0l/P  $PH (00S8/Ѝ0@/CTSD12p@-PP` 0R  0/V 0@/@P$Pp ( Q $0S /P (0 / p@/CTSD-0MRЍ/H-8R0 M 0  Ѝ/LHG-M,PU@(`(( $1$/q!1TppV @@a#T-:cP "`\/Vc 0R c ~`P"  @ aP :  0Lp#_`ЍG/_$ 0ܬ @-PP@p` M 0 | ^ t/TT   T<1H0@/p`0 x Ѝ@/dKTSD8@-p4 M0S $$ 1 /W R R  0@/P$ `^ ((0S 0/((/w| X0 @, 㐊, @"L, 0儊@ Ѝ@/PKTSDlp@-`PPMB 0 ^ ^ @/@ (t0\\\/ (/@0`0 0F`Ѝp@/$CTSD @-Pl M0`Sp T L1L/U 4R  1/V 0/W 0S  0/(PX $ RP t 0f@PP `(0/PP  (08@ Ѝ@/PKTSDdD0CTSDO- M8`p,!1ᴣ40P, @5 5! 0 , 'PP, 0 6o wPP, x0 埉\0pP, 嗉@  `$00<0弡( ЍO/^KTSDegmnTO-MpDPH@L`尤joP LLL1L/U,4 01$/T 1/V 0S  0/ 0@lP@ R s@P (@00SZH /@P Q@ЍO/<D0E-Q@pPM`0 /Tpt p0 ^ T/ 0p@P 00$ЍE/4p@-H!M0PS@`P (( $1$/T  Q  0P/'P  0/V 0P/( 80SX  8rPP zqPP(8/PPqЍp@/PkKTSDdmLn+O- A$M^@ 0/]  0bS$^Pi^pf^`  0a\^X  0HP0 H $ЍO/Pd!O-!MM΍P;.`  S8hqpP`nN @,8WWWl8{k80qpP8  {mpP(PyQn͍ `=@ym^  [m,H~^ P [,m\!0 p|pPU8  KmpPO@~R|P8  >mpPB(P<-P 8 /mpP3((R-,HP  P, !!0P~N @ A,V[; 88 @ pP  Q~ 0p pPp8(R pPDЍۍO/ (]\p@-PP@0S @@ <1</U $R  1a/T 0/z`P)(,0Sh$  bQ] ^][]   0lS !]$Q (`,/``p@/PKTSDd8@-SMML@P A,ZR~p`P1[- Mߍۍ@/O-AMPpL@P`帔 hh d1d/lP D0@14Q/T$ 1 /V 0S  0P/PP'@ D0@ PP Z 090 ( 0SX /@P@P P ЍO/PD0E-@M^p`P |0Cx/@@<@ 0@ @PL@P D0 xЍE/PGdA-pMP`P@00S.S@@ T@dڵP@D TA<P@D0$ sPЍA/$0tO-S,M@\p$@ @@ tj l3lc/YLT P3Dß/40 ,,3S/W 3b/[ 0S  k2B/ P"25`P  2~P d 2\/$ 0~d@ 2娅T}P $   Q$@P$00o @P \$@1 0 $ ḡ 0SM (8@TA ; `H!1PP@7 h1+P X @1/8 n@P+n@P& 0P (8/@P n ?@P 1 S@ HPn a @Π 0),ЍO/P`+|D00:$O-aMMPp  1/jP 1a/$t_1t/\!RPhh1Pa/`1S 0S < 81/ `P7BO ,XX  0@]P^`% \!0P `,@P `,!YlP ,! QY KP`긱,1`0MߍO/Pz{|}D0~O-`;M0 MS   3ß/V R hx t3ds/$DWX3Dß/pP(40Sx  鮍P @첟 T  2Ÿ/;P,W宍, +W W@Pr @^PaX00 ' P_ {PZ ̍ @P,W0 @PLoPPAF 1 R ? 1A/ P ` l1\/0S< S: &v@P ." , X.0[ X.0  @p 9 S (p4/p ; " LߍۍO/PZKTSD[d|$ 0@-|PM0Spl \d@0@S <0S/@T8 R㦌,\Ѝ0@/PTPDH@-PQM@P00` 0/p0S  0/ @@k`O/`@Pt@P@P t@P h@P\@P00 Ѝ@/PDHLT@-X@M%L0SD  <00PB$$ [Ѝ@/P4< @-@@/0S  0$! //@-@P44 000/0S00@/J$"0" /@-@P44 000/0S00@/W$"0" /@-@P0 ,0,/0S00@/$"0"H /@-@P44 000/0S00@/q$"0" /@-@P44 000/0S00@/~$"0"/@-@P44 000/0S00@/$"0"0@-$PlMU d  X00f0@0>0.D0gP00f@KlЍ0@/Q 0@-$PlMU d  X00f0@0)=0.D0gP00f@KlЍ0@/A 0@-$PlMU d  X00f0@0>0.D0gP00f@KlЍ0@/1 0@-$PlMU d  X00f0@0>0.D0gP00f@KlЍ0@/! 0@-$PlMU d  X00f0@0>0.D0gP00f@dKlЍ0@/ 0@-$PlMU d  X00f0@0>0.D0gP00f@BKlЍ0@/ p@-M`V0P@  ̈́@P@   P@R   C@001$@0 Ѝp@/$"G- M @ 0@KPP.pP@ TR 0RP TTTUPP;PP@pl`Z:@ Kd uЍG/Q 0@-$ PR@MXX0XX/  0a!S0$:Y0Ѝ0@/$"H"0@-$ PR@MXX0XX/  0a!S0$:X0Ѝ0@/$"p"0@-$ PR@MXX0XX/  0a!S0$:X0Ѝ0@/$""0@-$ PR@MXX0XX/  0a!S0$:X0Ѝ0@/$""0@-$ PR@MXX0XX/  0a!S0$:X0Ѝ0@/$""0@-$ PR@MXX0T/  0a!S0$:uX0Ѝ0@/$"#p@-$P@`M@ ( $0 0$0Ѝp@/$"p@-$P0`M@ ( $0 0$0Ѝp@/$"p@-$P `M@ m( $0 0$0Ѝp@/$"p@-$P`M@ V( $0 0$0Ѝp@/$"p@-$P`M@ ? $0rϠ 0$0Ѝp@/$"p@-$P@`M@ ) $0 0$0Ѝp@/$"A-`@@ 0AThM<@0P  U DpPP  JSTP@ hЍA/-$$0M  S\ @  p3Ѝ/-$$0M  S\ 0  p3Ѝ/-$$0M  S\   p3Ѝ/-$$0M  S\   mp3Ѝ/-$$0M  S\   Xp3Ѝ/-$$0M  S\ @  Cp3Ѝ/-M0L?S _PЍ/@-@ @ 0l?S 0M_@nS0@/- M :_Ѝ/0@- @PT M _($0.~0 0 Ѝ0@/$"0@-P$@< <0M@P@ 0 u_ @0Ѝ0@/$"p@-M`S0P0  @P0   P0R  . 00J01$@0 Ѝp@/$"G- M @ 0@'IPP.pP@ T) R 0RP TRTRPPoPP@pl`Z:@ Hd ЍG/A A-`@@ 0AThM<@0P U DpPP  QRiP0 |hЍA/-M0L/S 3_PЍ/@-@ 0 0l/S 0^0sR0@/- M 1_Ѝ/0@- @PT M ^$0IΠ.}0 0 Ѝ0@/$"0@-P$@< <0M$@P0 0 _ @0Ѝ0@/$"p@-pM`hRl0P   @P  l P R ͣ l hs  0hPl01$@0 pЍp@/$"G- M @ 0@-HPP.pP@ TR 0RP TQTQPPuPP@pl`Z:@ Gd ЍG/1 A-`@@ 0AThM<@0P U DpPP  PQiP hЍA/-M0LS ^PЍ/@-@  0lS 0|^ yQ0@/- M ^Ѝ/0@- @PT M &]($0 |0 0 Ѝ0@/$"0@-P$@< <0M)@P 0 ^ @0Ѝ0@/$"up@-pM`hQl0P  @P  l PR : l h͢ 0hUl01$@0 pЍp@/$"G- M @ 0@2GPP.pP@ TR 0RP TPTPPPzPP@pl`Z:@ Fd ЍG/! A-`@@ 0AThM<@0P U DpPP  OPiP hЍA/-M0LS h^PЍ/@-@  0lS 0^~P0@/- M e^Ѝ/0@- @PT M 5\($0 {0 0 Ѝ0@/v$"0@-P$@< ?M.@P 0 C^ @0Ѝ0@/$"p@-hM``Pdz?P  @P  d PR (d `rᶚ0`[d01$@0 hЍp@/$"G- M @ 0@9FPP.pP@ TR 0RP T!OTOPPPP@pl`Z:@ Ed ЍG/ A-`@@ 0AThM<@0P U DpPP  NOjP hЍA/-M0LS H^PЍ/@-@  0lS 0]O0@/- M ]Ѝ/0@- @PT M ]($0 z0 0 Ѝ0@/i$"0@-P$@< <0M5~@P 0 ] @0Ѝ0@/$"[p@-`M`XO\0P@  ~@P@  \ P@R o \ Xr }r0Xa\01$@0 `Ѝp@/$"O- M @ 0@?EPP3P@ TR 0R P T'NTN PPPP@lpY`#`3U`V@ Dd ЍO/ A-`@@ 0AThM<@0P U DpPP  MNeP@ hЍA/-0MS  YPЍ/@- @ 0bS YN@/- M YЍ/0@- @PT M Y$0] y0 0 Ѝ0@/$"0@-P$@< O0M9}@P@ 0 Y @0Ѝ0@/$"0@-@PMP( 0/0S) 0|/U \0\(" 04QA0Č,!Ѝ0@/@<4#@-@P=4 00 ( ^ /@/@dKTSD@-@PC4 00 ( ^ /@/@dKTSD@-@PI4 00 ( ^ / @/@dKTSD@-@PO4 00 ( ^ /@/@dKTSD@-@PU4 00 ( ^ /@/@dKTSD@-@P[4 00 ( ^ /@/@dKTSD@-@Pa4 00 ( ^ /@/@dKTSD@-@Pgd `0 X ^ P/0 , R PP!@/@dKTSD@-@Puh d0 \ ^ T/9 S, R PP  "@/@dKTSD@-@P4 00 ( ^ /@/@dKTSD0@-PP@ M 0 ^ |/T PHP Q T, 40$ࠁ/A Ѝ0@/d@KTSDH#l#0222222222/0@-@PPM 0 ^ /Ul| x0 \ \/ \0HH04/00@Ѝ0@/|##vEHCAw{P 02"/0@-@PPM 0 ^ /Ul| x0 \ \/ \0HH04/00@Ѝ0@/|#$TECAP0@-PP@ M 0 ^ /0DP xT T P 0$T< 0yr Ѝ0@/|#$EHCAXcp@-PPM 0R  0/P PlbV`BT  0/@lB` 0@r 0 0p ⒥B @R 44 PЍp@/EHCA|#$%4%L%p@-(0MSP`P44 010/V R  1@/^  0/ @Wr0 [j0S0l 5PHP0C\<ll )PP $(p%Ѝp@/|#{x%EHCA$}%%8 ` %L%p@-01 MR`@  1/P  0P/,  (0 j0Q O, (0R SP S0P(0 P0`CQ0XX OU Ѝp@KЍp@/(|#&@&h&8 ` &&A-Qpp`PM 0R  0/0@WPP@q 0PiPh OD R 0Dp\p0ZrAPDD oOЍA/EHCA|#$'''8 ` D'x'p@-PPM` $1R  1/P DO(P) V `@ 0@ @ g(0 íP@ @E 0>ip`` 0`5i 0BS0@@ OЍp@/EHCA|#$%'8 ` 'L%@-pP MP L2R DD @2@Ÿ/U (Q  2Ÿ/<0S$@5D `V00< (^  1/<(^ 0 0< $0S d| |1`/< $ HA< @1u@T<aP<b?0<, 0yu<@8 R 0\ 0/08>:4P 0Qh 0d/04 {900S067, R,(P(.7 Ѝ@/EHCA|#$TECA((( ( 0@-PP M@ 0R  0/ R0/T P u 0/ dPCT 0S P0 0 Ѝ0@/EHCA|#$+(0@-0 Ms@PE (P44 020Ÿ/ "(P  1/ R000S  1/  P00 0S `t t1\/   0sE 0^0 ,1 / "0SP  0/$ R 0 00P  0/  P$0$00S <h h08/$  $ Ѝ0@/|#():D)h))))0@-,1 MR@ P  1/U Q  0/0^ ;M Q 1M$ ,D@ 0AS18`` M @R HH MЍ0@/TECA|#x(EHCAy${%|)0*L%0@-@PM 1R  1/ R\hh1\Q/P0M@!LP P"PP3  1%wP P*   0 P P P P P N5 NCzX0 STX P 0P XP 0P0 LR 88 LЍ0@/EHCA|#$+%L%E-`PM@P4p8 3R 3ß/T Q  3ß/0^t#_L QLhh#ULU,X040PUX 060Q  3Ÿ/04 60 97W9 Xb 2R/8 7,`"2mvP<n X < `PP$p e^vPP` <(^ P$P<(  <0(P pW!1< PP"(PPCX  PPP9L R@LH@L@ 0\@ @  0 @0S ^$@@0$0 @ LQ K B0P2! P 0AS1d K LR @ KXUL4 B6UЍE/EHCA|#$TECA(%)+/?c0*fnoL%O-@PM`< 4R  4ğ/X P t |4pT/V Q @T P4 08 ]6<^x 2t/ < ^<$0#00IP @ BPe hh"J`L l(Z $( 0  0 ( 0 0 0S@  " 2⨢ BPR X!JL ^00 (Q  1A/ 0(0 \ 0 0 $^ 4 41@/  $  0@ 4E@D$@T @8 Q6 R  Q50S 3P \ ЍO/TECA|#(L6EHCA$t*** +0+G-PPMp0 1R  1/X P T` \1Pa/W,@ <1(/DQ" `028L 16t@P•`-  `P L 0p0$00000 0  `M(@D,`0`4`8`<`(`F2HdD@ЍG/EHCA|#Y$ZT+[+nyTECA@-M  t0Rll h0@d/XX0(LL 0c(Q IЍ@/|#++8 ` 0@-@P M <1R 4 ,1,/PP 0k0P0I,Q,Ip^' 0S0 0GI0PUCN0  p P0 0\ll 1I\00<TT )I0H0/0x Ѝ0@/EHCA|#$+H,,0@-PPM R 0R  0/@Pʰ 0/0CQ00H RPP pcL` \0H/00QЍ0@]Ѝ0@/EHCA|#,--p@-`PM R d1R \j T1T/PP,4 01$A/@AT@9~  0/0  R g 0/ R  0R  d0`@/ s@d4L  0LoTЍp@/TECA|#-d..(EHCA$p@-@PM  6R  6Ɵ/ Rp||6pƟ/PDT&3H " P  0BS0&#Hx` P\%H Q000^  5U/`   P00 Q Dl l5@U/ 0` ` 4\+ PU00 L0S  5d/ L  P00 HQ  4|T/0H `@0SD/`@0 PNUQ44$G4 R 0S0s Pa0S1#G $\ 0 0P h 3dS/0   `V$0$0\ \ \3 S/ $ `$ 40S+ PU00 LQ  2b/ L \00 H0S L 2HR/H `@0SD/`@ P0@S1"G4  RG 0S0s PU0S p 1la/  2IC `P00QXQ t p1/ X PU00QT0S  1/TP0P/ T0mPP ”A0BP P0" 4 FЍp@/EHCA|#$+%L%)../(/$0*+-L/t//7>/BH0x0EKA-(00MS`@P  2Ÿ/X 2R/ R R  2r/0^\||"PF P9@\ 0X T2,R/ q* pW LQ  2/ L  P00 H0S  1Q/pHp   J,0”S202$lqPRp@Pq"H 2@!00”R P$”(R,P`h 0CP E|@$Pg 0P_, R pp 0_($0ЍA/|#0TECA0%111028 ` L%22O-,M`pW 4R  4ğ/pQ  4ğ/0 R `t p4\ğ/(0S0(0 S@T 4 04T/ P Y#XE$ @X 3ß/d$Px 3tC/$ 1 R!8ll#0E$ @P H [ @1@!Q:,0S@L PbU S$U0@@T<@$ \00 LP  2|Ÿ/$ L $ ^00 H0S 0l l2,Ÿ/$ H$0$$$@0SD/$ @ $$$  0@S 1!DT$Y$, R H^$ A!0@^ 0@S0 !D"=JZ[Y PYH D1@/P \ BQ D@0 P@f 0P^|(\P ( @0$/,ЍO/EHCA|#'$ 3')8310%`3Bp3G)K/(/U0*38 ` mL%{33@-M  R  ,4R $$ 4 ğ/ D@Q#&D@T `SV K 3s/l^ 3ß/H00X PaPHN`#C 4pW+ ^00 L\ ( $3c/ 0L0 Q00 HP  2r/H 00`0@0S D/@0 paF\(TT"C4 RPP`V PAU 1q/lP 1/pP@ ^0S hW 1d/Q00 X R (h d1$/X^00 T0S  1/T!, 05jP @BP@T@TpBWPP0S T 0P/ @R xx 4CЍ@/EHCA|#q$u%-04)?/(/G0*VWH4]45ag@5zL%G-PM@ 0S  4ğ/ R4T/TxA 4tt/P$h4=mPPp  &pP D/4ipp'e pHpLplrpr ᩚpP I0#B"pp  ,@""tBxr|rrrrrrPp0  @CRT@X@0\ #X3lP v  43 Q@X   ( P,    X  p`` `P H0"|[B-`$$ Ÿpb(0@ @P H|0x" DB"`,`PX"X2BP P<"<2BP` `PBQB0S.@ R00h!0BVp02PHppBT \ R00xx!B^d `1/AP 8 41@/ 0S @  R0!0A@ T @0h @4/0hrЍG/|#X5D05155&BT65{E6'(ak$6EHCAd,e-fl6i+lnp@-M@`p2P  1/ P  1xQ/ pR Pd `1H/@0S,PAPQ  !uA B^  0/0SPHPPQP(^(K 0՚ LR Lx LAU (\ X0 P/Ѝp@/|# 36EHCA$%6'L%-P- 0S R \ ^ 0S P R0\/0@-@PPM ll0m ` ^ X/0 S0<<00/@Ѝ0@/66lcaDP7 R0 \ 00S/\ \ R ( "4!̃,T P/R  0 SQ\ R/ 00/\p@-,,!0`S000 @P" @@00  u @A\ @TP@ " P LRꈠP4P L\ X0X/<@UP:p@/TX6p7\7>X@-@ MTp |1R tu l1l/PHP L1@/0CQ`P =0SWTS4 `d$ <@` ` @` ` @$ h@( @ @Xh  ^  p 0S `ЍA/6lcaDp@-0` 00@PP PPPp@/@- M0P0%`p @P 0v03 R@P00p Ѝ@/  A-<`@v$$ 1 / R00 Q\0S  0p/\Q00 QX\  0p/ X p<Q0SHd `0D/P0 BQ p3A/8889h?<9/@-@X0SD0  4!0(0@ 0 0@/,O0O<A-p@w,, (1(/ R00aQ0S  0/Q00`Q R  0/00`QPHl h0D/X 0BS p3A/880O\9,O9< 9x~0@-PP@ M 0 ^ /0DP xT T P 0$T< 0\^ Ѝ0@/89bdaD@-@PMPp` 0R  0/U Q  0/ 0n@ 0S0d|| y< 0 0 AP88 f<Ѝ@/bdaD8] 9IAda^ H:a :j :0@-R00M0@0 Qn~ 4> tt> `<0@-@ M0S0!|:0Qlt p1p/0P ER0 B4(^$0$08Q0S ( $1/$ $PU(0(0P^  0/0(  $ (P@0   R0PU4QP P@\@@  : Ѝ0@/8`;>8>4>;E-`Mp2X 0pV@(0S(0000"9,2pX4P X0? 400 p644 g40 +pPl0l0 0S | 1/ll Rp0p0 ^ 4L P1H/p4 0800 l p  E 1/@0 0  @0! 0 @ 0@ <(L^(H 9 @Tz 2hЍE/T >8*4<4?P?p?L???^tt>d`<?@@-PQ`Mp 0 ^ ^ @/@pp\t p0d/0HsT P0</p 40P^Ѝ@/0@8IAda@@#@-PQM` R T1R LL H1H/@ppP   1/ q  0/l~  0/00s  0/8 R d 0`/(pP0(00dd 8L T0T^Ѝ@7Hbda8AAB4BdBBB@-PQ`Mp 0 ^ ^ @/@pp\t p0d/0HsT P0</p 40@ ^Ѝ@/&B8HNda*C+C.@-PQ`Mp 0 ^ ^ x@/@p8 |X0HTH/~LpD (0]Ѝ@/CJ8ZbdalDNTG-PMQp(`F `40<@ S-*T8080 P  0/ 8 8^<0<0 0S  0/<08 1 <QV\ PFP`T@ЍG/8DD@-@Q Mp R 1R  1/P``p p| x1l/Q DX T1@/~ 4 01/0`/<P8080 0S  0/8  8^<0<0 P | 0x/ <0081<00 RH D0\ Ѝ@/Ebda8rDvtEwExE~EEE-@q`dn\ M 0p R PPP!C7L1 @P=U㠀 , (1(Q/ R  1/@Q 0S S l@tw 0P/P'U {P@T0@S0HH 6 ЍE/F8:,O FEbdac[p@/Nbda8HII JlJ J J K0@-PM@DP IAЍ0@/A-@Pp 1R  1/0`V dQ H P1DQ/PUp0s S*|0S  n |4 4 pPUt0s S*0SP  P t4P 4 tPl0s S*@1l0A/Nbda8KbdaD9KK@-@P MPp 2Ÿ/ 0R 0 R  1a/0`V \  1|/ 80 R QP-  |P @@# P@PPT0SU  0@/@4PU P 88@0S _ 0S [  Ѝ@/8q<NbdaKbdaDv9K F@-@P Mp @1R 88 414/P!)4Bm 0P R`  41X8P BP  /Pl 4P R @R 8dd 30CQLL 3 Ѝ@/bdaD8 9 K K  0L L Lp@-`PMP R 0R  0/  |PQ0S@Tp0s S*t0s S *l0s S*0 @Ѝp@/Nbda8L E-q`]@ Pd M 0S0 3 P 0C\ P(  t3P"QXPU@/ PP P@ \T04P0 CR ( O3 ЍE/|M8K/L F0@-@PM 0R  0/P )3P!PPx 3UP!PPh@d 3T0U LR @@ 3Ѝ0@/bdaD8 9 K M M LA-@PMP` `1R XX T1T/U <Q 0 ,1q/ V 1/pn 0 p@T@ 2 V0@bd6@ 1 - f@$@@S0,0@S0@@ 2ЍA/bdaD8A 9IAdaB H:C NF :T :0@-@` M0XPS LQ DD0D/!s  Ѝ0@/0,8vN@-PP M@ 1R  1/T 1a/ R  Q \t p1Xq/`V L1R @ <1/ pp 1nL@P 2,00 (`NQ| 21pV P@|| 1m 0BS0\\ 1 Ѝ@/bdaD8 9 ,NIAda H:Ebda G : : K Lp@-@PM R 2R  2Ÿ/``(PQ("1 @P( 9P  1a/1S%`Pf>N_f 3x`P[ >``S'S Xd `1T/ /?#;P 0 ,1a/`P6>N鏍6 x`P+uO ]T6 $p|6P0H6 {$q60  ~<0 !?`|`V >`ЍۍO/4_8U,5G-`P#M 3R || x3xß/0Z \Q @P L3M@R  >Ο/Q  RT``>TN/`0S (<<>(Ο/d\ >M/|P ^  =͟/tQ T4P  =M/  d =d͟/pPp, L4p-P@P@C ",@\h<4 $lp80(DHLPTX`@d 0S0 ,M'0 N0R00 d ,B'<04@b4 P4`4 @4@4P@` Q \ X<\/D@  1- `V$`   ,' PXP8`5P  80@  @  R PU` ˟ @T A4P` ``+&`@U pr ` 0 ,;崺/ V\0@00%8娠0p 0 R \0SV R P u*&PV 0@0 R U T<H*O`P @3 `v;@PP <x):L4eP` T )~&`@@2)< lpt@04@8@x@|@@@@@@@ !X0S`\` @X8IX` < 04800804 0@80@0804 80 0807`V00 A\0S  8ǟ/\@T00 AXP L L8g/0X0000 `@X RP\P@ XXPppP0'%l r p R#%*|`V.p r p@R(*% p )@Pl )`\'TT @@7TT5 4ǟ4gT T (T @T` ` R"t r p0R* p P Ɵ P (@3@BT6PP P` |@T  0S  V 4"!2@#  "@  P    P  p4`(|:;p !n<ⰰ @T@ll%L%  ( 0d P0<0"@PX   R@0@0@@AT@$"% Z㄰6Lp nL0 ^,td$ %(d 0P"@P 0 S@@ @,@LQ#$ [ 00y0 !n̂0`@AT@x#$4 0`S\A` @T`0 `P`,V* 8P40 0@4Tp 4l 4p4004@0 4@4 44 4 44 44 0  4 P0044@44@40 4 4@4 0 @ tP  @-8@P A40  440S |V0 4 1/00y0 4X 4P4 0T0$0AS0 4(Q(r8^8'40S4#< R< \0 0`Jl!\Q @!T1C\@TXQ@ X^ CX 00TaT 0@@@! X0CXPQ 0BP^00p \00Pxx  @l00 $` 0YCLЍp@/$$$$L_T_laa+5;=a>bAp@-`PMdV \1\/PU @1R (4 01 A/PW!?\ 0@/00CS00@0H00nP @@Z 096P@(p@LQ,\\  T Ѝp@Ѝp@/L_hb$$$$ZT__]bb8  {`E-@p0 0$0p0(0,00000M` }PPPVXi  sP '"0!(P #tl VtPP "X0T!@, @ PP0 P@{PP ! 0!"P ,` 0P P  0PPP PQ R0SoyPp\ VQ00 H mЍE/ bL_bPA b< #6d= : $6O-MD Z븁@@`@ 8D"0GPPpm WTpXp&  "0aEPXpWX T@Qp` @ X@GX`Q" T!W0pp@ppPp1\p0h8LP    0PpPA p@^ AX TaT 0X@Q !0 @AX@ P 0AP0S00` ^00@ll @4`` 0uAJЍO/L_hbcD0$$$$p b a p@-$0PS`M 0\ @T /V 0||@/ P;  [ T @d<HD@ 0h4`$Ѝp@/,cL_c8  p@-$0MSPP\\ X1X/Q  `P (@;X !044 " `P V P, ^ 0  "P P |  P\| @X @;hH0@ 30$0nЍp@/L_Ux%c8  mc:{(dp@-@M0`P DD @1@/ 0R   1Q/Q  0/P(  $0 30S0 ( $0R SP S0P$0 P0`C\,X {U Ѝp@9Ѝp@/L_Lddd@&h&8  &&@-M @ 0P0/  |0Rh `/\\0$PP 0^3$^ Ѝ@/LdL_+d8  @-,M`p0P HH D3Dß/4 R $ 3ß/$0S5$ 0S0"Q",P @  0,0 AR Lpp"0CP $PP"S R @To  Q2/ PR R  1/$0$ PO0d& 0P S 0!4E(QC  Phh!0<``A@20PU(@ * P00!Q @ P: 0P2wm$ R0S Q T 0P/ P0 ;,Ѝ@/L_Lddd&&e,cISNDLe*f8  HfJ:|fRep@-M@`(0P 8= 010/ P  1Q/D R <^ 40S X\ PEQ x 0p/0 PR0u0X iq0@S0 @@ U Ѝp@/L_f6_f`@-@PX0 ,0,/000 00@/ff@-@ 0 @/D C @-@ 000@/xC -@-4@ M0 0 Ѝ@ Ѝ/--40M$$ 0P a1Ѝ Ѝ/ --40M$$ 0P M1Ѝ Ѝ/ 0@-PP@M 0 ^ /T 0p ^ `/0/,\ ,0 /Ѝ0@/ggDSNDg@-@P 0/^ x0l l ^ X/0/(\ (0/@/gggDSND@h@-@P8 40 , ^ $/@/gThDSND@-@P@ <0 4 ^ ,/0@/gThDSND@-@P< 80 0 ^ (/@/gThDSND@-@Pl h0 ` ^ X/8 800/0X/@/gThDSNDh@-@PD @0 8 ^ 0/0`/@/gThDSND@-@P88 40 , ^ $/@/gThDSND@-@P88 40 , ^ $/@/gThDSNDp@-`PP@0  ^ /U 0 ^ p/TPd `0 ^ </ 0/p@/ThgDSNDhi0@-PP@M 0 x ^ p/TL\ X0 ^</0 /Ѝ0@/gTh*DSND+Li-0M/Ѝ/@-@Pp`PMXZ P0 H ^ @/ 0/Ѝ@/gThDSND0@-@PPM 0^ ^ /t| x0l/UL` \0 ^ 8/0/Ѝ0@/gThDSNDyhz0@-@PPM 0 ^ /t |0p/ULb \0 ^ </0/Ѝ0@/gThDSNDhp@-@P`P 0R  0/  0/V 0/U Q lf 0h/ /0S$g <0 /p@/DSNDgThh<ip@-@PP` 0R j 0/  0/U Ql| x0d/  /0S $< 80/p@/DSNDgThhii@-PP@p`M0  ^ x/TTd `0 ^ D/ 0$/Ѝ@/gThDSNDp@-`PP@0  ^ /Ut| x0l/TP` \0 ^ 8/ 00/p@/ThgDSND<0@-PP@M 0 ^ /T 0p ^d/04/,\< 80$/Ѝ0@/Thg DSNDi 4p@-`P@P 0R  0/U P  0/T Q 0|/0p\00  / R $@ <0 /p@/DSNDgThj'Ljp@-@PP`0  ^ / d ll0`/U@T P0</ 08/p@/Thg1DSND2dj30p@-PP@`t0tt  h ^ `/T@  D0</ 0</p@/Thg?DSND0p@-PP@`0  x ^ p/TP\ X0 ^ </ 0@/p@/ThgQDSNDRjA-@PMp` 0 P ^ |/UXh d0 ^ H/ 0PH/ЍA/g}ThDSND~jA-@PM`Pp 0専 ^ /V 0/ 00U00S U  RDX0H/ 0T/ЍA/gThDSND0j0@-@PPM LL0L D ^ </0d/Ѝ0@/gThDSND@-@PD @0 8 ^ 0/0\/@/gThDSND0@-@PPM LL0L D ^ </0h/Ѝ0@/gThDSND@-@P\\ X0 P ^ H/0t0S  / @/EgThDSND0@-@PMP 0R  0/<P |5 0x/U P HX T0D/l0S/Ѝ0@/DSNDgOTh0kQ- MxUPPKll hh0h 0d0d0`00X0 0   Ѝ/lgXkxp d0 0@-PPM 0STT P1P/DAP,P)PP! R00 A^  0/00@T00 @P  0/ @  $ 80f8A8PP < yЍ0@/g6k`l;kdk l>,l0@-<0M@PP @TЍ0@/dG-`Pp  1/X 0S \h d1XA/TAP2<OP,,!+PP &PP5  / 0h;@P PP" 2 P@ 4P| ^@P@PH@OPL< @G/g*hl`lk,ld*A-PPM`@$p 1R  1/Vht p1d/!X  R0DD10/T 0(S  1/P 0/!R  0/W ^P T 0P/ 0@ pP/ЍA/DSNDgTh0lRSNDLllmG-@PMP`0p48 1R  1/U 1/V  R V00S  Xll1X/ Q0L H1,/W ,R  1/&P 0/1S  0/X PP P 0L/ 0L/ЍG/DSNDgTh0mnRSNDLllnG-pPM`@8 KpyOX@-@P 0 ^ /Zx 0]h0S` D0E {0 C\00 8@/ztL/8 A 0@pW p@t#m/8 @NpPLßL#0Zm @ ^T @TT @ <0S PS P@SoP 4<@\@A4 & M)41CX4q P&l R 44&  ]LP  6ş/v`@pF 0S0D%20 P-Z7  ^ 5LP 1LP P` MP !LP  MP ` 4P MP LQL$@T' P0R ␀5      v@X㠀ld$d0 CR PP$\d@."P_PP ⤻ | p`L@   P:?hÆ,h @K PF/P  Y F/`X{P( KP$ P !@0SzW!pp\  J봂P20"%Opp!  | ┻1ha A TP6a,`("(2A@T% $U0 `AV@@  1Z0 !Z0!Z! 0aQ zG;`@Q@z TX 0CP P  A\, |d!`IߍO/rgMDttXp5! "\~#p~$u%MNOQcgmL{,\/uvFG ܀  (DTUYA-M@PHpL`P@PUP 0Zh `[0 P HPLPP~p3ЍA/h0@- P M 0 S0 0!$@T0$0 RL'SJ'H'UF'D\0D1 X^VPf0!R 641S041l P{ Q Y@TC @4DW/0"+Ѝ0@/t}@@-@PM 0/ R 0R  0/@Qt @D @0LS04TT wZH 0TbЍ@/tԂrgMD\l@-M  1R  1/ 0@Q\hh!D \00 P $8 41 A/0  \00P  0@/0   Z  00 0 y@BP U@AP$D TЍ@/ t\ăA-PPM@8p 2R  2Ÿ/oP  2b/ `tt2`Ÿ/ <X T28b/P 00" ",`P  0BS0n i 04 m?`PX 0  `  o ` ` `R`PC @,@p!p1 \2 TR 0   0 R   0 CQ  NZ 0 Z0T < zO` 3x 0CQ hX /ЍA/rgMDtt@`\  D 0@-@PPM 0 ^ / ^Tdd0X/ ^,DD00/gЍ0@/ttrgMD0@-@PPM TT0T L ^ D/ 0 SWU iWЍ0@/tt9rgMD0@-@PPM PP0P H ^ @/0SZ⡸Ѝ0@/tt)rgMDE-0PM  2Ÿ/X 0S p| x2lR/ WH"\2#PP @@ RHA@ @@@$@4ADA N$PKSOL F$PAPn.?$`P8H%QOHHL%LL Px%PP\Z8a5P!7A!0pN@TX!0{ P h%5P0X!@B r @0  00/@P5P 00 0 0x4P@h  0ЍG/lD08 h (dDZLD܉E-wMP`p X1R PP L1L/V(4 01$A/W P B 1P/@P4 1'@PT@D 0 @ P  ' 0 /P TT wߍE/DZLDlt*-M⸍Ѝ/G-(MX@`P0T0/ 2Ÿ/V 2/U 2Ÿ/h @ h倀 0SxB ?\@PXp\T  !C@P v@T$BxW4P B⯅O4P A0>gF4PAI$PA0  ቑ@PR% b7@PE  /@P=p@ P x|@ ,0AȠ,$,:|P7@P" @A0@0 @PT  剏@P0h 0h0 H+P  ?+ЍG/Ȍ<6T.(*)O-0M`P22 4ğ/Xx 4tD/  RDXX4DT/X  PL†奲pQrrߡR R2K/KC$"($pቡ, Uṿ`R  Ő@P 0p6U@P_7p@P  h@PO -X@Px" R 2Ÿ/ 0A2?@PwN@Pr\O E"+> P@`Ph ̍_%f@PZ )B@PR_+p@PK 0 T@PB<% `1``BZ/B*@P2 2@@ @@B R 2@@" B@PP f\PP2SU  p%` ,05 `"QߍO/j6kTn$]PE-wMnpV! PR㬠0 ࠑ/01僋@P,    $ P@ 4  h@wߍE/DT-MЍ/O-M`ᄼ0pK0  :@P0 0 ݼP P i  \0?P@  0ưPp ЍO/$ O-PMpP@`S? 4ğ/XtZ x4pğ/TL\ X4Hğ/Y$< 84 ğ/Z 0.S    4S/  @PP 1PSV " 1PS1PSi Q /PP  PP`4@ @ 9 P"8 aP 0v_MK/ nR6*3#Mʰ~{ -?PPV'`@3V`Ý @P) T?PP 3 P1U`d%%!/! G6PP`3##PP@S鏍V %X#娌  PPP#0 03](U `R[ 0P 0 |PxPC(ߍO/g*LiTjD0k(*)4 P+_-M0PЍ/_O-@MPp`PCC 5ş/P |5xş/WX \5Pş/V0 85(ş/U 5ş/[ 4ğ/Y 4ğ/P$4ğ/ 0RT%*ᱞ \ 02ṯ,.$@2WEW̍သs @"P20C20P2R噞=@PP\ h#0P8P 3  uPPO Ý. 0QPP /JPP bPP `8@ 5+ PA"6nwO7B/#+9 >.?oPPk`@3V`#@bP) 嵈_PP H3 1^tKt%%!/!S ^嗈PP`-#!PP'@V̍#RP 8® T? P$QP#\0 03du # 80LPߍO/*LT̋D0,4 J+A-P8MPp`< 414/U 1 A/W 0/V 0@/0S  0/0PP  dx0`@/ @04 0-4 0`8ЍA/*ZD0T,O-ŸtMT0p`訰P[lP夐HH D2DB/Y , (2/@P 00 PPP@pPV<pP@ OT0l0y l0ZP>l  P%lܜ ! al~Pl@l府 @4P@&Pll P缜 l RlT0p03Z0#SPZppp@PϷlPlW @LJZ@DtЍO/-M $(, FЍ/@P/E-`QMpx5 p2pŸ/00S L6 L2DŸ/HPP@4 1' $ ܬ $ "XvO*~/--"44QpH t1h/""4f4 " 2+u,0 ᗂ.m;";c^Q 0/":902+ "E< ᗂ 0 /9" + ?0OߍE/T8p@-PM`-x Rt0t0 0S  0/ttQx0x0 ^ | |0t/x 0x0t0@| 80@@T 0Ѝp@/HTx@-pMPP` 0 ^ l ^ d@/@R,p& 0pЍ@/ᜍHTdwFA-@P`PMp 0 ^ /+P\h |` 0WL0P@@q,P( jЍA/H@TdwFĎ0 E-pP M@ 2R ^ 2Ÿ/ !`0PP`r `@P| D x t 0Sx@@xt@x`Vi0|h!@+PHtL!  JZ`,Pv! V1:x\t0t0 P  0/tt^x0x0`0S  0|/x xt| <0@T 0 ЍE/TdwFH@LTxA-QMP 0S 7 0/ 90@P` p 0 Z`P *`P`L@QQ 0lЍA/Hԏ TdwF0@-@PPM ll0 ` ^ X/0 S0800/@Ѝ0@/ lbaTP7p@-PMU` 1R  0/P 0@/@AT@$0S  0/ P v" @ R P X0H/@ 0Ѝp@/lbaT 0A- 0M@p` P0P  0S#P-X R Q  0S R   2 V `V` Q R @@R U @5T 00ߍA/E-`P$MP@ 1R D 1/ PE 0p/  TUT0 p0  !@B(X  0@@"P  T !0SZ$0$00$ЍE/lbaT ̑ p@-"0M`p @PP @(0<    "PP00Ѝp@/ lbaT0  ̀0/ < ( Ġ0 /0@-MP@Ѝ0@/0@-P@MЍ0@ P00RccP/$RQllPa/p@-@0`S@8 P> P PU@0 "P8P @P0@P 80Q: P8U:hh d0d/@0Q R 0 40,/@0 p@/ؑK(/0/@-@PPp`M< 404/1 0 Ѝ@/ؑ 0@-@ @PM >]Z Ѝ0@A0@-PM0@z P P0 P@(D@< 0P"Ѝ0@/4 0@-P0M@z P000 R @0 P@a(40 ,0PY" Ѝ0@/D p@-MP@ `PЍp@/0@- PM@z0P@ < P@*(0,( 0P""Ѝ0@/T A-@8P@/@-\@ PX0!h0 !@.@/p@-PMU` 41R ,, (1(/|M<Q 8@!0 <@Q 8 0! 0@0Q @0@ pQ xX0t pPguP0@@0F/0 @Ѝp@/RUOJؑO-MMhl pNPP@PPEB.B%05@Pe ``F0%5@P[^  0 PPP@ 0P0@0TCl(4,\ (h^00lSچN O)@18!@Wp0Q*  B΍@0P@lȝ W^(0pj @0 R nQ40PbU:dR8 T@:@΍l@P΍lX80cS Q4@\(bQ :dRX(^PRl8`0 ^ll h3hC/`Q lq@Plhd4 `R` `o V1##>:pP ld@P ph @PPeP@lU@1 u @P PhH@PX :h@Ph8`ȝ(h^,lhȝ0 P0 h84hh@Pkh@ "@Peh@Pah.@(h @PThȝX80@S @PHht@PDBnN`Fd ᭡p . RP PPESP&P@ ᗡp  ᒡp S> ?@@BAS \ x0* lP. +h8S ΍%BA~S@BNyStЍۍO/HlؑeO-QMP@ <4R 44 040ğ/T  4ğ/ 0 #P@ C#0@CP`,4^C @ 3R l 3hß/Y <P  0h030C/\ 8o k C@P  @Pl @P0 QBz @PvO| x0xtx^Xh00 X X T"(2 $"0"@OXtP` |0P]P'\pId[ P!0P H  ?PP -\ \ @= @@H!1 @!0\P@_"  @P ^  t 3 8<Q @ h0 <Q R>0 <0\[ ЍO/DSNDؑ,Th-`+ 8%RUOJ8hE-pQ 0PP  `dPP} PPuP@TDP(0 pCp p͍ PUl\hEENGF^0 hč@pčlčYPP EF0  pxPPFl/3o6l\ᗪ ֪@  3 m@P  pXᡪ@AFTo `T PlP PPF ®G UE=  ^YpPH4L$SR R :$R  7W/^ 7ǟ/8 "YGPCpx0A G~ x R  $R <ĝX a` TPX0X0BY   5t/` XG~!`0T`G~X<`PX<4`8čT0`PX`0>A^LP:$X\T0T0 P ,P L4(/T $$TQX0X0 4S  4s/ĝXPTĝPTPtXP<4SX<$8T X4<4f$8 XPT0T0 Y <l h38s/$T$TQX0X0 4S  3R/XčTTpX<4SX<$8T Xp4D88po@AP XYT0T0  Q 8t L24Ÿ/0T A^P TPX0X0 Y  1/XAP T 0 WX  <YA.X<4 P8T0 X <@T` P5H$L$@TU U-DTUP U&8ĝ\(($!$0tC>PP4S  0/$R t |0p/CEGEEGJG|ЍۍO/ؙЙؑXY  @ ` O-lMLPph  (0w`@P" 0d @@P[@PLp@P S  $0 d lЍO/ؑlG-@QMP 2Ÿ/ 0 #Pp 2r"0prP "@| |x"0V|\ 8\ X|(0 pPT|@<p0|xt p@l@x@p0SX X | p!0p"p1Xl@`x t0@bPP#\`NdZ Y@T|A@T T Tp Z \@ Cp p|0  0m<Q | @ X0(<Q p|0 (0\|ЍG/ؑN`+x 88@-@Pb4 00 ( ^ /@/doNK0@-@PMP 0R U 0/U R Q  0/ 0S0x P\V p0T/ B0@Q0 @@ Ѝ0@/lbTKdoNKU$WěZA-@PM` X1R PP L1L/P ,(1Q/V[ 1p/ pP PP 0 F@PP00 @Th] 0d/@P0@fP_@ _ЍA/lbTKjk@n\x@-PPMp@ 1R O 0/P 0`/T 0/ `Pp   0 E`@PP@PR8 Ѝ@/lbTK=>\p@-@PP 1R  0/U P  0`/ `GP Q| 0t/0^H T0@/P, @p@/lbTK$,DxA-`Pp @1R 8G 010/W Q   1P/X 0S  0/P@T:@7T PU R Hdd ^ B0Q0J< SPA/lbTKdoNK&ěG-PPM@0 1R  1/P 1a/X P ` d1Xq/ pP,8!   ! 0D`P. @T 0/ @咈Y庈Z @T`0^|  LR PAp @TV`PDD ЍG/lbTK\xě G-PMP L1R D <1</U 1A/ @ 0Pp0 P  ``" EPPp @  p 0@0 $ $` pP@P iT  0CЍG/lbTKdoNK0@-`P M R p1R h `1`/@ PP04!7P 1 q/ 0CQ !\pppp3NQ P|  W T?;0S00D\  $ 0 Ѝ@/lbTKtě04A-QMP 0S P 0/$ R0!@P`) p  0.G`P` `P| P `@^00<lH >r$ 0ЍA/|; lbTK40@-@PP M h0h@ \ ^ T/uPD 0] Ѝ0@/doNK@-$@$0 Ssn@/0/@-@P 404Y0/ O@/ȟ0  0@-@PT0 M,, @/00 Ѝ0@/ሡ@-@P|| x0 p ^ h/8”H0SH 8282(C\0,, 8„42@/ ̡ءxtcLT 0@-PQM@ 0S  0/T R a 0/82Q8 @P| 0x/@ R@"Hl h0D/80@S82DD @Ѝ0@/̡xtcL,D\0@-P M@00kϠ 0T Ѝ0@/x̡O- MP<#3P   ` a R00 0S tx t3tß/Q00  R ,0 43,ß/0 0W@pppPp @T㘡$*^00 W  2Ÿ/p0SP0PS@ @P P@@U`VPp8 `a\00 P  1/ R00  0S  1/ W@pppPp @T 㘢$*^00 W $ 1/p0SPPP@0 @P0P@@U`VPp X Pt p0P/[ T< 0 ЍO/̡_ k ,Lo l~  O-w? M PP+ `,@ pZPwnP  hw! V0d7 pp`7plwpwtw @P ЍO/x̡@-@MpP`P @ |1|/U d1R  DTT1DA/D Db@P> Q^* Pǒ \ @T 0/ dG dǒP@@ d7@P @l' 0l'/ @P` 0D2 Q?Ѝ@/̡xtcLءO-IM@ d,P0LqP`Q  0S  3ß/Y 3c/ Rh||3h/ RD\3Dß/ R @@3 c/X$ 3/rP 2Ÿ/fP 2b/TX1 T^S  X2X/4"!>`P D8/PtT@ T ( $2/"2  202U 00$P(0$P$ PPO@(P,Pᒔ:P@PAP$$ p, TPL0pHp4pLp8<@DpR H >Ο/@l@DP ppDZHZTP` <8LP\tx|. @`(΍00,$P ㄐ 08P00 @

 <2S 0 P PPP , <Q QR 44$4)T S$XX$44TTZ>p@n$ 0$PP# "U UU , k$ 0/@41 9S, w <–0\85<2@RLP% 0/@4 S $O,0^ <^5<2@7% 0/@P4P Pt@Tl% 6xPUl&86|\ l4&=PL&ll6p@$ 0FPP/ "Uxt|~ UU- ,* <2S@⥎EPJp $0PP' "Ub UUc ,` <Q<2@. 0/@P4P|@@ l.>EP| p> $0+PP' "Ue UU , <"RP 0Q4^. 0/,  <HPPt><2Z4\L0H0 \%R ETh8>΍PD"K @@,Px ,(\.=O@.=I? .C@0ST? P= d-)t\. 0N@僈PL*Pʝ R *t$ - 0/\>P|00: h^> IPP |@@, 0/% 5S S S S 'S S5SS S |BH<, 0/PP )ɍ)ɍx ;P ;P L K@J0  wP,(0S $P@N +T@l 0/ ܇$P@x*  <% @$0 v@$}P DD*Ta ⴅ ̍Kᶋ5(*;HR@@(΍,J0Q̉(:KN.0D N 䉍IOɝ\90 )R h d9dI/ Q90 9΍ S  9I/ X))?0ʝ L:@T*&PPPU P /P @t 0/UP L84ȟ/0S 0'`8d@T 80+88Z\ +8P U UU , `W  P@ HD XTp 0SrpP aPj (P< Q P @ k   GPC @^P⡮T pt7N0 0H P PPP , <"R _PP *I 0l /U , <P@4l)MP 0P\ PT\ P %RX,@} p^ $0PP" "U UU ,@ <2S  gPG -=2N$>,0 U UU  <^%-<2 @0@P4P00 ̍P.P 00S14 R. LUU 0/ H  0H L4 ),@L 4H " 0/,L <2H@Sd=<2PU4@TL0H0 8 R , 0/8@ L.Q@^, ΍ P ,XP  0/@ \5SS< R ,@(Qt 0/<, H0$ S:lHp < P%Ul+P@D@L@ P- R00 @:S d t p;p˟/@^00 < P  , 0;(˟/ <*Z000@P\< l !16 Ppd0DT@!PHX@0PW `)H 0/0Q@<00Q&Q$Q@@|@8HxtcDLBx0@-@PMP 1R  0/U P A 0/0Q E R 0|/ P Ll h0H/ 0BS0DD %@Ѝ0@/xtcD8,D\E-PM`@0P l1R d \1\/ P 4< 81,q/@ @ @ pP8 `d`& 0P @P 0d  0 }P @P p 0  d Qp  'ЍE/RSND8L@-Mp`@P0P0 0 |" P}ߍ@/$8p@-`M@ ѳ'w0PP -wЍp@/O-`PdMP 0p 3R  3ß/UP P\ X3L/`d [\ 0,  @]P \ d\04Ƞ0,Z0 Q+ \ 0P@"0\w@P@` p2\Ÿ/T]XP: Tv}\0 \0 Q\ 0Pj @Pd \d@\@A\T  0APU! RpHPLPG \0h`  0tP;^  ,P# /0@@ 0a p9PTX R T  ᰁP @ Pd`dЍO/RSND8gLk:lD`dtO-M4M *pXP0S /  ~P#[J(|\p, (0Iv0P@E   A<@z3 P?YPPU@Y 2貟/  2&uP0 Q AT 2Ÿ/!\tvP x  R()H20B/0 d2S ` ^)  Ỳ P  1A/* ʍ \ $0u@>:\ u`dᓲ 0N@T!H1@` @P0 $ MT ɱ: $ \0@F@P 0 lx   v0 Qa[[1Z  4ЍڍO/83 : XO-M P p`bP "@ 6'GK 0띟P⦯K. @ 2  @P 0B"@@P ቄ 4x|"0 ߍO/l$8sA-M8.P` p@FP 0 0@' 004PF0P @@88 <0 "0ЍA/0 <@-Mp`@P0P44 4 " PWߍ@/e$8E-@Mp_tP 0 PP` %'`P&`P0P0 T0@LHD 0P _>ЍE/8`0 E- Mp`!10P@PPg (0 U  20,0$0(0222202R UX1T12<H D1D/0]PP   !3+E$ڝ$@Q00#:, $ݡPPWP $( )P$(q D  ,0@,^,$\$L /0 ЍE/8@  X$xtcDO-M `元@} ᲃ2S Q|| x3xß/ hCR  HXX3HS/@~P 7 (3s/ᓰptX 2Ÿ/ᄲ!(x=~s @T\ |2XR/xP N |0bP*< 82 r/n|@PPpP@hp~l \1|%%!/!l   0n S!*P 0!p1@P;  1p/ n겱/l0 P\~P P!x\ P: 0P/x| 0wDP 90 4| ᷂PP PЍO/8jRSNDkL:zĵ$8T@-KM`$3>P@ ~K.P↮@<K ~tP@M BT T;0S? P\``#ó" L$" 2r.ύ " $"峮}zw Q 2B/ 0!C@P_ 2R/,囦@RG90, (2,2yT2@PP5P @,;P$"k0p@@$( 0(p/@P\ . ,"00–/@ᩁTN$,Ǧ@TJ–\ PU*PT^= TQ!@GcTDQ<HPPP!E@0B0S2?2HP P#0" 0@@(,堦P\` @$$嶞T@x!0ߍ@/8 :x+4XI'@B0 A-PQM`p@@CPU00S @ 0`@RCUPUP @ 0`@U"P"U00S <@@,( 0ЍA/Գ0 @-M@@0,8 P0 !s0Ѝ@/ "0@-PP MB 1/@T 1R lx t1d/00P4HH!A PU4 01/ APBP P!+U/P^00  ,(0S$( !$ޚ”\NQ X 0`Q 8 l0W "`/0^ Ѝ0@/8@xtcD"H&L'X+xp E-$M@@P`  0p@P 0!D@@@@Ph0@P` \0\\/R 0 @ $0$ЍE/Nd8T- M Ѝ/G- M@`pH!H1pppP6@P`E  0`P.T` 0``P  B!DH d"L02B 0"``PP\`@\T, 40Q  0 ЍG/8 -/-M $(,0 Ѝ/0@-M,@P(%0@P%<0@T44 000/Ѝ0@/8d- M Ѝ/G-M<`Vp8@@P 1/T 0/U 0/@@ 0p@p=@PMd RD0"8@PHF8@GЍG/8XQP0@- QMP1/0 R  R  0@/ Q@ @P 00z 2S " P T R@ œ/⮰ Ѝ0@/8qxtcDsHE-MP@p`ᐢMPpp  h""ϿP@X 0  0ߍE/lE$8/,0 0$RB4 400 /00S C 400  $04 /@-@04000@/,0 /O-tß|MX PXDD @3@ß/1S $ 3ß/[ 3Ÿ/xP } 2Ÿ/.P 2Ÿ/yPXyyP Dl h2@B/4`X\ 6\`pp4@ᑫst R* 1/t0`^t 1|/᧬P  P dt R/A4▬Zt@ T<18ࠑ/ᆬ@Jt`V 1551/1ի Z4pp`5t0S  p4 0ᰁ1,封!$ ( 0   |ЍO/ķܵ*D@p$Lp p@-4@PT`MP L0LL/0!Ā 0Ѝp@/ܵO-pğM0`X@@ <4<ğ/1S   4ğ/xP xxP  3C/ᄐ @p `Pl  P@pᐪr̠Z*0 ,3ß/0 b^ 2Т/ᦫᣫpveP| 2xŸ/ᎫR@0@岫S* @2Ÿ/֪  uPD ՗  y@PLm PE ራᅫ<@〩  M@P,H PR:0aCQ:< 81A/ H0<PcE .X  p@PW@ RL@Y:p 0l/ ( "ᖘ0l`0 @ ЍO/ܷܵЉж+/p9(nT}O-CM4MğBM< 0Xpq h4h/0A A$** 0S@ p@* C=0 @"JŞ $Pz .Q/QQtʍCm !$`A}$p$ C@Pᝨ:@TXC嶪B=$C-⊨PvP@:< 2蒟/h&ᖪ"w"hw F P2CŸ%%!/!C_ Ry @P"w@B}A$pC=T$` Tx $@Z! T1 PU~@Tk TgQ[#C͍$PAm$`ᑼī@PW: RO85  Z CA=J$$ާ  Iʍ ʍ0S S P ᾸPATЍ@/rdrOhG-`P p 1R Y 1/ W W   W\0P/ ^0GPP$ ,@[ ⎤ᄶ 㥽P\dd ߩ`.屠岐q 0SQ P PG/rdrOh`@-pQP M< 0` \ @/>0| @P0 00`P D0 G` 00@ Ѝ@/غrdrO0@-PP@M 0K ^ /TL 0|/ \TM`0T/ |(Q80$/PЍ0@/LRes80@-PP@M 0 ^ /T 0|/ \T`0T/ |(<<0$/PЍ0@/ĻvrES8-MЍ/0@- M0  #@P 0\:00Q0S  0R@@0  @0@@ R@0 @0@ Ѝ0@/0@-@PPMP L0L D ^ </P00Ѝ0@/D=vrES0@-PP@M pp0p h ^ `/T<L H0</000Ѝ0@/DIvrESJ0@-PP@M` \0V P ^ H/0 @ @ Ѝ0@/DvrESp@-`PP xx0Y l ^ d@/UDP L0@/ 0@000p@/DvrESe0@-PP@M` \0\ T ^ L/0 @ @ Ѝ0@/DsvrESp@-`PP xx0x p ^ h@/UD L0D/ 0@000p@/DvrES0@-PP@M` \0\ T ^ L/ 0 @ @ Ѝ0@/DvrESp@-`PP xx0x p ^ h@/UDT P0D/ 0@000p@/DvrES0@-PP@M` \0\ T ^ L/< @,@ Ѝ0@/DvrESp@-`PP xx0x p ^ h@/UDm L0D/ 0@000p@/DvrES0@-PP@M` \0\ T ^ L/0 @ @ Ѝ0@/DvrESp@-`PP xx0x p ^ h@/UDT P0D/ 0@000p@/DvrES0@-PP@M` \0w P ^ H/0 @ @ Ѝ0@/DvrESp@-`PP xx0x p ^ h@/UDT P0D/ 0@000p@/DvrES0@-PP@M xx0x p ^ h/TDT P0D/0S 00SЍ0@/DvrES0@-PP@M ||0| t ^ l/THX T0H/Q0|  &e0Ѝ0@/DIvrESJؼ0@-PP@M ||0| t ^ l/THX T0H/Q0|  d0Ѝ0@/DjvrESk0@-PP@M ||0| t ^ l/THX T0H/Q0|  d0Ѝ0@/DvrES0@-PP@M` \0\ T ^ L/@0 K@ @ Ѝ0@/DvrESp@-`PP xx0x p ^ h@/UD L0D/ @0@0k`p@/DvrES40@-PP@M` \0\ T ^ L/0 K @ Ѝ0@/DvrESp@-`PP xx0x p ^ h@/UD  L0D/ 0@0k`p@/DvrESL0@-@P MP 0R  0/Q x| X0<U |4 D0P | c Ѝ0@/vrESuDy~0@-@P MP 0R  0/Q x| X0U |4 D0kP | c Ѝ0@/vrESVDZ_0@-@P MP 0R  0/Q x| X0U |4 D05P | c Ѝ0@/vrES5D9>0@-PQ@M 9d0dd/P ;0P 0 400  0Ѝ0@/LRes0@- @R MP0 Ը8, ,0} 00 Ѝ0@/@-MpP@4` %!cvO c0  0傿@P0 ,0P@ 1ʰ!@@P, P0D@P, ,0 Ϡ*ߍ@/&p@-PPM 1/ R |C1|A/ R d1R DX T1@/@ R441/P@UP6`^ 0` /0S I0/`PP`` K/ , T0`Q h| 00`M 0Ѝp@/ dxvrES 1p@-@PMZ 2 Ÿ/ R [1Q/ R 1R \ 1/P R|a1xA/@AT@Q0XS  @a4o@1/ R s$1/ .@T00 P x 0/  P00  0S |x 0t/  0000 @ R~  0Ѝp@/,LResDľԾ@-pSP@`M0 / 0m@Pt 0 pa 00`P 0@Ѝ@/$vrESp@-`R@Ph0dd/0 S S 880  (/ 0p@$Xp@-`R@P0/T t0R \ `0T/ @ P@T @p@/LRes< 0R/1/G-p@`A`p@1  R& ZT! dPUxw p0p/U T Ph PDU*, ,0$/UG/̿ؿ0@-@PPM 0 ^ /Ul p0 \ X/ \0<00/00@Ѝ0@/TSLPh@-@PMPp 0R  0/ U``UPP 0/ P  Q  _P U0PV 0PP  LR ( Ѝ@/TSLP0@-PP M  1/@T 0R  0/ PӬ0՜P/PAUPPQ x00!L0P R0 00HH BϠ 0 Ѝ0@/4TSLPt@-@PMPp 1R  1/U`` U  R0/ P  bQ  P V   0S 0 `N D0E_ AP ( >Ѝ@/TSLP A-@PMP 1R  1/U`` U  Rtx1pQ/ P HP! Q  iP 0V00PP02QP 0CpPP% Q 0!_ !0  pP ᲀVP L0^P 0AS 0, ЍA/TSLP @-pQ M` 0S N 0/ P0@PP PP Q0 0`Zd [ @0i PPPP$ @ Ѝ@/htTSLP@-@P88 40 , ^ $/@/++TBR0S 0S 4  $ /0@-@QPM 0/0S |0p/,3  Ǡ0 0!! ,0!Ѝ0@/J*K@p@-P`U  5@T00 \8/@$\  000p@/!`p@-`QP 0/@T 0|/PQP0 @00   R@@@p@//2p@-`QPe 0/@T 0x/PQP0 @00   R@@@p@/S@-@PDD @0 8 ^ 0/0404@/ -0-0@-@00@/0@-PQ4M@hh d1d/ R@LL1@/   (1\  0$  ( ,   T 0/,3  Ǡ 1(",1 0 j P @ @ 4Ѝ0@/V*WQnSND]0@-14MR 0$ p  (,P  P 1, 0 0 7  Ƞ,<,1厲P 3@P@@@ @ `@ à Ǡ  , Ƞ,,  P0VA `F 4Ѝ@/nSNDp@-@PP` 1RP 1/ 0S Ĕ\0,0 R 1 $ 0 R 0\  E0S   4 CS1 $ R00 RU0 !à0 0 Ǡ0 0,  8#,, 1P V  &P D 0S 0p@/-0-0B <@-PPM@p` L1R D <1</V000S? T- 1#7  , 8#, 1  P 0/ 0@ A 0W $R  Ѝ@(sЍ@/-0-02@-PQ@p`M 0 ^ /T 0t ^ h/'P 0o80P Ѝ@/ +TBR -0-0@-PQ@p`M 0 ^ /T| x0` l ^ T/ 0400PЍ@/ +TBR -0-0p@-@P`P 1RP 1/0S  R 0 0S   G PE $1 Ą 0S PU 4 0/U A1$   R  RQ R  0PX 0p@4S p@/-0-0< 0@-@PPM HH0HH/P /Z00Ѝ0@/8-0-00@-PM@ZT @Ѝ0@/0@-!KM M0,4]0Pč@ˍ @DK404$$$$$$$W+i5[Ѝۍ0@/nSNDp@-@P`TZ h1h`[U T[ RV PU  [P [)tZJ[ `^ Z fZ Z ZZ00S x([  0S  D[ P@[p@/TP\dlD\h$@-@P"< 80 0 ^ (/ @y+TBRA-@QMp` Pᬀ0 /0 0,00 ( $R EP  ᪴0( ZލA/snSND0@-PP M@ 1R } 1/T5 Q P.Q P& Q P $P 0S/E 8L#,,# 010C Ѝ0@/+TBRE-P Mp PU 1R@ aE 1/PU@ Q  1/@T@5@0S 0S$P 0S/`\`V` ^00 0S0 08 #̂,#0 W@B@ pW`@T!^ G 0l/Q  >0!@0@I@ 0@ ЍE/+TBR0%-MjP 娚Ѝ/ E-P qd%&O-M MP  0倘儸 (9R  9ɟ/ 9/0S ^  8ȟ/0 S 8吨/Y (@@D" K P jNPxb>-@P C M`ƍuVVFFF FF F$FUEO `F  @,tHTLT0D4D8DU, @.0Pȝ\ 0S, $   P! 0/  0PP P  X/*pPKP ? \ЍۍO/+TBR2nSND0H $sPp@-@PMP` 0R 0/ 0/ 0 fP$0S  0PЍp@/+TBR2A-M0p W`P@ 0 ^ t/0  -0S $0S 0ЍA/\O-@ 0 MS0: 0`uP`#  pQ:p +  0PPUp XX !@0ܼ ᆳ +  0 ЍO/O-p M\` 1 A/ pXp l1@PX/, H14! @P,0= 00000 (0(00(Ì010(0(89 .ʠ70(ppp p$pp p0x10;T(" , 4T0@0 ЍO/1O-M MP  :R   : ʟ/  9I/Q PU  9i/ᣎ@΍.⠹&]` 0 P9匹iiiii娉嬉iiҏI囨^ ;P8    00@^[p"-~  強ggggg؇܇ggiN⟏͍a> P A wV쵍eeeef ff劏p 8w/ O.@͍^ 0 A p<ܻkkkkkll d$d(d,d4d8@dDd04Y `4D ` `pA, +ˍ1&]H$ , +彎; P @ >K孥P@ P <S `<P! c0Ĥ R ` \  (vL6(/4n !`{PP z 5ş/Qe \͍ 0 e 0C㐤_.@ @De 0↤ OPL P0  @@\ V\ 0@ @T,`V <P0Q<0\@ca 8ǁQ.L,'R+g 7AfPcÁ k,;SQ.l pl1kč PP00PBN   @Nk0  <)S<0 &  c0 QY\ LL H3ß/^Q  3Ÿ/P p 00PT \ | 2xŸ/P P H 2DŸ/P0S h d2Ÿ/p  D TQ 0 U[XP @;"Q 00PU+kP @000& P,U @T  ,m 0/ 00  p&͍  P8 ЍۍO/+TBRuv2wnSNDHxzh$@-pPP@` M0  ^ / h ll0`/ p"5P P$0S $` Ѝ@/+TBR2E-`P Mp0 (1(/W 0S  0@/z3X  R0/  0㹼@P P@  `PPP\ l0娼P ,PP00@ 0' ЍE/D0d+TBR0@-@PPM ll0l d ^ \/p0 S0@@04/pp@Ѝ0@/W4DBRY<0S#3/8/0@-P@PM0   ^ / \Xdd0X/8\D @0(ࠑ/@Ѝ0@/4DBR\@-(@:#^(0`@ ʠ,ˠ N.D@@0 \$,,0 ^$/@/-|0/A-@PTp`1 0S 0/ < 01 0g0 $`0(:0,0 0 4r  0P0890A/ 0/-0 'R 'R Rd0 Q//@-@P\\ X0 P ^ H/ ( 000$/h@/4DBR,0 0$RB4 400 /00S C 400  $04 /,0 /p@-00@sP`|| x1x/4 R0000(*";P $0 ,1 /("0ʠ,;!0Q4040(0  ˠ1S  0/(4 :#!( 0 4 ,` ʠ,;Q@0@0(00 ʠ,;4 :#+Ap@/ H-M0 <,0ٺ 0P4 0800 Ѝ/Zp@-G `TP& 0 S0/2`ʠ,; 0l 0SP`0^2`ʠ,; 00CS(( 0Np@/E-P@U M  0p `/` *" 0l0Spp 0&0 2`ʠ,; 0 0CS,, 0 ЍE/D{~\E-@MTPp  F `2 !+ ` ``0S0 \@!( (0S S 0 S 0V  V@T@T !+ ` 0CP(00 T@ЍE/?\iE- p @*"ˠP`` 0P0PSM0 $@ \ 0 U U0@S @@T2  +` 0LS0$(( mT@ЍE/\@-PPM`  (1R   1/V P  0@/d@T! p ˠ` 0S0 3\2`*" 0LS0Xtt #d  ,P L0(/Ѝ@/4DBR4|@-PPM@`  41R ,, (1(/V P  1p/ p*" ` 0S0 ֎(0#6 0/(  &(` 0\/2` ˠ 0BS0HH @Ѝ@/4DBRp@-@(0M` P$`"4`0`Ѝp@/@-01pMP`H!̸@L0SL0 q R0/T @# (!6 0/( :#&(0| 0/ ` 0S @@ @L@\L@@ 9Ѝ@/  p@-PP` 0  ^ @/Lx0S L0@ P\dd0P/ ,L@0LS8 L0@p@/4DBR(A-@RM = <0`tP P\\ P/V@@ <0`0!0媴ЍA/3L5@-@ MPp |0| `0P@ PP H0 Ϡ凴@p  Ѝ@/p@-@P`  (1R  1/V P  0P/Q  0/L0^L f Rx `  H0PP  PL 0BSL0$HH KUPp@/4DBR@-pP`P M0 /U 0@/V 0p ^d/@? xuH(0 00 Ѝ@/D0p3E-R M`0$(@,Pa 0tW 1/00 @ ˠ` @0S00< Q H 0S $Q H $eB vshH 0,ЍO/,p X@$7G-,P0 M X`$p(@ 1/ @ ˠ` @0S0P\\!V  5 :V  $8 41 /R V 9 0BS02 jA^  90C\"  嵊P%z9 NR \| D@H@LP@8 @)?@A@ЍG/AGTXZ`@gO-Mp$(p(@`  P8q0$(/ 0$(!q, , 0p4p8p pXh0(0徠$ a/.ᰡ$ (a004p,08p0p 崝ЍO/ p@-4@PT`MP L0LL/0!Ā 0Ѝp@/z-M Ѝ/ O-P M`P ((1(   ^ A/1 HL@P$p}*0, P~r  P PP PN ⁄w "D w m},WX#HH0@0 ЍO/Z4DBR\ ISND0@- @RM|0||Px/0 ST\0\P/P P<$8 嘉Ѝ0@/ - 0MS} B0Ѝ/E-@, MR`p((T 4S C *P7V0P 4W, ʠ,+ 0` ^ R,$6pX 0$R6" !;` 0BS0(,, 4(0('Z  ЍE/dE-(TMU@`R| p*"ˠ` dp0S0! $# 'RR QR0S0JQ XQR V0  QPP0\7 0 P p ,T(d t$$P C ⊜P ĈPt P$ tP ;` 0LS0 D\\ 媈 'R (PЍE/d.'\n0@-@PMPP |0|| t ^ l/PP <Ly@wP40 pЍ0@/4DBR 4O-M yo0)^!3” @P@ⶔ ޔ  ?0@P "p:#[ ` `P"+pC`$P \0gQ W``PQRPV[pPQU1V& 3PWPSP y 0J@P%Y  6FU Ý 6=P@   P@  @PÝ 2! ` 0CPT`  U T RWT8@ /RpߍO/{ d./!@-M`0Pp 0*P@ 0ࠑ/0 Dҗ PP00  (0(Ѝ@/bxE-M^`:Op͓ʓ *@ ,⿓   P6: ?Í4PC ` J$0S0% 0$@ 0R @T .  `0CQ T  }hPP P N:  0YP CPߍE/I @-0a@ MP pP R00P ,, (1(/0  P00Q  0/  (0S$^  0|/ P d @T@TT 0@庠pG@TW Ѝ@/_@fp8  p@-0P@`p' h0h/0 Q0"8V hIhep@/p@-`MPမP0,@T |U 0+ ,0@T kUX H000044 0 Ѝp@/?BCA-@ MA0@S`  ; 0q8 (04r\.{0Q Q  1/000 R4040QP  0/480Q4000 ى8\t $ < <T 00墬ЍA/r0@-PM@H@T Ѝ0@/@-@MPp`@yT @Ѝ@/O-P\M p 0"  ˠ  ` @0S0#{00$@0$> 6R!KCR3(0 R H`X$  3@$@0 ($ ( RP=@ R R@@T0Sr [) ,@㔑  I @刑  0j[00Y0,`S[0H@\ (p倰6 TQ 6 J0  Q$ !$P KQ00 ф0 R  Ʉ& P & 0 CR lt |3YP I p@w \ЍO/s ,.P  O-(4 MSP  1/ :# p` @P|!s$@ p5 6RKCR+(0 R  H`W$ / p(@(@ 'Rpp R0pp p @TZ @T  W $(,T@0L@0CP88  ЍO/ t ,.'T PO-2BMʠ M,`(` 0 ,3$ R P- (@$6 @@@6@Ɵ/(0C!FT( P 6ş/0@S0 5ş/t3c( "6 5ş/(0C!&R(Q(PPH$@Pp P U$ t@T YH0 0L[L|L $僃L|0@SL0|$zHY \ 4XT/$Pd$@p ^ğࠁ/0 \  0 Wp(@T 3  @T0 [@$@$  P @ P : Rp \,ßࠁ/ @ T8 43@Q 0  [ $    P$PUP(( 0Sd l2`Ÿ/0CQ,x <2(Ÿ/$ R| PyPX PDPTrnPP@"ɂt3X) (^PUEq嚔P (+@!0`ʜ P+ @pl!0府 (.0Sq < 81/ 0\`` 0 0`PP X PtP D lPQX P6P,ЍۍO/-4P8  |A-WMUp J$ ``hd 0S\0( 0(0AS(( 0 'ЍA/,Pp@-'PR0/ @T0SEo$}/f@\TT T    }>@Th @p@/ p@-'PR0/ @T0So$}/@\TT T    }>@T4 @p@/ G- @MTTP``0SW ` `  }>q@P$}/0w@PT@ @ЍG/0@-@PMP  0R  0/LPLXdd \0SUL LRL ,, LЍ0@/4DBRO-XMU`c 1@0|!PJ@T00P&PLLL!@P ㉿P$,,!w `P J$;^ 0 0C^ [  ( P\|| P0 KP,TT ׀00ЍO/@8  4hP, @-@ MPPp00PU0`S` S TT P0P/P᣿P$00 PXЍ@/4p@-PM@` @0PSP }@S 0|/2 @,h0iL H(08 A$i00Ѝp@/40@-@PMPP 0 | ^ t/᪾PX X@6@2P40 +Ѝ0@/4DBR 4-8MR\  (0Q:# 1S R *Q wЍ/O-U >Ο/~j8`V0 08Ne ^j}8@x`<`F:G΍ @H F  $(WN^p8G t~j͍8P PHj=8@P˷P-WyjM8-@P `@:j*40-PP.$@(xp<G(TUʍ* $Q j8`JP㸲 !{ ` 0S0   -yx<`N$ \02  R2 `ʠ,` (`pAWp( ,y j}g_M@+b `\b (D\sჅ 08`P @I_ 0*PUVxp80G`Fj}\1UN(@@Z $ P@ _j]00PPWJ p`*"k  `0S 0 +xx0z$PPP$Pⴊ4jMZ/ZZ% 8p``^|  $vjⴚ $@.P p`ux<0A0P0g4@Tc  R#ßj :8 x 0D 0TzZ嶁j6ʍ唇P" 0(`f T(p@D*:jT"z'ˠ P80`PN\PP"#ux<@RRʍQ (pWj- 80;xp<G ā:*0[ j Bz8:ʗ 0YY j=ʍ8 z 0L,Qz Sʍzj-s!; 8` 0@S0 #tSj=s8 PƳP#tx< N Q% (D*Jj͍j8 @&;`@ \DPP$tj-80 0CP$t P 80C Zzz@$\Ix0<C \x ,BߍۍO/O-`P,MpP  3R  3ß/H <0 GPP@408P 0!PȀpXpPP0 p0 P$P,P(`ʠ,+0^#/t  P$p H`P !+ 0@S0"tPPU pWmPj 00e $0  0R4R7 $ < H0DPP  H$@ P$P$1U HHH@PPG    ,   $ ( H/ 0R*, (1/[@$@p@(T0 u 3(0\ R  HrPT 02 !+` 0LS0 (X@ }sLP,ЍO/4DBR\Cm`@-@PM`p  0R  0/H 0塝PP' @L 0SL0 >st d| x0`/L t0BPtL(HH (sDPЍ@/4DBR&(258 A-PPM0 `  1R  1/H!1N@Pj   0 S QՐՐ1Հq/  0S0Ld `1H/P  44P ` 0 0pp"`p! 0S0 r( 6 0p/( !&(p 0l/pp2`!ˠ 0BS0$dd r(@ЍA/4DBR35B\CiSND R\TUYE-`P MP@r  1R  1/T 1封/,P,  (ˠ` 0 ^ Xll!GrW$ @.p,0Q K?CQ00( ( 0 0S S S Sp@ RT 0 ,0vW 4 ,0m BPLhh rT QDD0  ЍE/4DBRo,P43@- @MTTP`pp(0S"ON$ }?&xPP  }>@PE P 44 000/@ @Ѝ@/M@- @MTTP`pp(0SO]$ }?(xPP  }>~@P P 44 000/@ @Ѝ@/&A-PMP`  L1R DD @1@/  ˠ`0^!Oq(0 *"#6 =0$ R @ p40 ,0@T W@ |02 ʠ,  ` 0BS0 $HH q!0ЍA/4DBR.1\HPE-BMMpP `  |2R tt p2pŸ/P  A @T& A  PU00*R᷂PX 1 BZ+AP@!0@  ;`@T@h!p$@?0 KC R X((1 , 000!8C0%Z   u0 ((X @ 0 QX  L0告@T2 ! ` 0BS0 XX bp$ЍۍE/4DBRT\d8  \|G- 0@S`pW XX T2TŸ/'R0<<20/PuV  Q}$0xPr R ؁^ .+` 0S 0! p32`!ˠ 0BS0Hhh!oǔ RZPC @^  P9 `V6Ȕ (W2` ˠ 0S0 o( 6 0/(:#&(0X 0T/2`*"ˠ0AS0P4 o G/ E-Mp { $!0`PC@c}P 0P PP0 `T 0 PE@:0ЍE/O-PPLM0D  3R 3ß/P{ 㺭P#Fop`p pD 0!@P@K  7P8HH#0o[<T@ 㖭P#"oDp @P!DD@\ ˠ., 0p|P `@P P XxT P 0T@"n@D` ˠ  0S0"nDD r  ! 0\0T0S=D0S  :#\ ` 1X/D  :#D R00" ;^  1/D  :#DDTD  :#D`*"ˠ 0CPP~ vn uP0p@ nnD0@0LЍO/4DBR$\@-@Pp`P MTT P0 H ^ @/`P H 0R Ѝ@/i4DBRA-0CM`  P00 RQ7ǟ/ R p/ t7lW/0SZ pW8H D74ǟ/0@S0  7V/ Q00 pW  6Ɵ/ P00 0S l 6hV/p0   \ D @6V/0vH 5p哔 p40Q-Q00\  5ş/ 0 ^00P H| |5Dş/ 000@Tp\PW: ^Pd000\_ B. !PJ0S 4T/PU+ B@cTP@@B΍B0@TOP P#0#<$<#A44$0@F@ QH, $ 4@mP AP@T d 3`S/ PNUmX @% P B +l+D3 `C A<#40@ PHP@`^Ÿ/`|0S0"0lP @\ PU 2:PU@@\ R/\ T |2:H!1 M@厓Q@@\Q/\ T 2: BHh1!@q00 R@r@\ T:H!1\h^hy\ 0H`0@L`@P❫pPU  D1@/ RLP0L0l6 !OlAP@<PP80H 奛ᙠ@CލA/Dt@h@B8  $ #5 =lGISZ<'O-` `!"p`Pb@t````x@|@ 0Pp RX T2Ÿ/p0C^p , (2/ v`a```!00 lPQ!\ !<1o0S@\o\ T@h!0WQ \08!0K hPhw \ `l0<` ጩL R0L0D Mj $0)p`&<ЍO/* d JLXdY Y x @ <DSND4DBR < @-PPM Mp  1R  1/W P 1A/` B` ˠ @0S0L``!i 0P `V`Q`` 0BS0!iV. L@PL iL0l C@BQl@L iT@|P +㴂y(||x x0P n Ѝۍ@/4DBRHx 8 0@-@ 0 MSP _,  H 0T Ѝ0@/-(0 M$0!I Ѝ/A-@MTM  1R  1/pPʼ 1Q/pPAUpP\`VTpWT`p` 00S 0*i``( 0BS,! 0i` 0 PS`\W!p:V- LPULP  iLl 0@PfSlPL0 hUP|P +|'xxt t0P 00ЍۍA/4DBR<zx 8  O-bM MP0$ƍ  4R xxx4xğ/PAZ O>E^G. p` ( `$8dn @ ɍ}s asMf.n^  Pos qas H>`P @28 .ˠ ` pW4 p|(fpi$@`6 R KHR-(.Q8 HP"V9$ 8@ i(0(0  P /Qp Q` @TW 0*{`P j 80`Y $ʝ 8080g90Z` H H`4 @^&qfV \QVd `dV $* :8 j$ʝ*:8@`OPM䉝 8 ./[[`000#@T@%:f9 $@.P0PP$`(`,` `j :R"KCR\ɝ(.pW8 HppU9$ 8pJP Ip(0(0@P9 R [XR R Y# ,\P$#0RP$P R 0R RP P RP(P P hRP,P PPP@TX `BV`Y <Y 0SʝS5 2 0S% JT 8Z J 8<6@ `(PP^<&V $08( ( 8cH I0CP "veQ 8)ʝ  ^`bb [[ R`V00[0SŸ VD 8<6P$@ PPT<& $ʝ08$ $ @b@WP 0AS000 !l e ^Pt!eU <&; T <&9 0AS0h4!e8PPHH!dX$R) `$ @)80Z%`@\ d 80@\ L d88HE{ߍۍO/4DBR ,Џ &,./exP..Y34 O-`PM0   6R  6Ɵ/P00Q: H <057@Pp408@P XȀ@@0 0币 @往$@PR(,P0@Z 000  P THPp ,,  0.P<LL%@d4$%<5华P' p0,@0@ y@P0  6@P 0@,  6@P  ̀弰0,,PP @T,, H ! P\ PcP$c @ Z%+`0^#chP @ J0 XB) ʠ,[P唐_h@P: KE^6(D0 R ( $3R/ P( ((( (0PUZ 2Ÿ/(X( 0x@!;!@TY5 (0D"PU < (2Q/ IP(00( ( ( (PUZ 1/(zX( 09@+X@@T P>P XX!5cQ0  @0@("PpP3 0@ ! 0 0`0 CR  cX PPd  cP00S d꼀 ЍO/4DBRP:Rh\8dE-1LMS@pbqPao ,pP Qad `P_H ``"?0P0PQ`QS @oDXD@\ b2 ˠ P !"H< <0D5PP6<@ 4 0 8P gaP80``P 0 P$P,PD(``P PD h`P D@!P000$V`LЍE/0@-@PPM ll0l d ^ \/p0 S0@@04/pp@Ѝ0@/W8DBRY<0S#3/</0@-P@PM0   ^ / \Xdd0X/8\D @0(ࠑ/@Ѝ0@/8DBR\@-(@:#^(0`@ ʠ,ˠ N.D@@0 \$,,0 ^$/@/0-0@P00/A-@PTp`1 0S 0/ @ 01 0g0!$`0(:0, 0 0 4r  0P0890A/,0/-0 'R 'R Rd0 Q//@-@P\\ X0 P ^ H/ ( 000$/h@/8DBR,0 0$RB4 400 /00S C 400  $04 /,0 /p@-40@sP`|| x1x/8 R4040,*";P $0 ,1 /,"4ʠ,;!4Q8080,0  ˠ1S  0/,8 :#!, 4 8 0` ʠ,;Q@4@0,40 ʠ,;8 :#+Ap@/ H-M0 @,0 0P8 0<04 Ѝ/Zp@-G `TP& 0 S0/2`ʠ,; 0l 0SP`0u`2`ʠ,; 00CS(( 0e`p@/E-P@U M  0p `/` *" 0l0Spp 0=`0 2`ʠ,; 0 0CS,, 0*` ЍE/D{~\G-@PT  K 00`p !;` P ` \@!( ( 0S S 0S\ 1X 0X@T@T !;` LP$,, _T@G/?\iG-0 0 pP`p` *"; ` @P _$@ P\ 1 W 0W0@S @@T !;` LP $$ }_T@G/\@-PPM`  (1R   1/V P  0@/d@T! p ˠ` 0S0 D_U2`*" 0LS0Xtt 4_d  ,P L0(/Ѝ@/8DBR4|@-PPM@`  41R ,, (1(/V P  1p/ p*" ` 0S0 ^(0#6 0/(  &(` 0\/2` ˠ 0BS0HH ^@Ѝ@/8DBRp@-@(0M` P$`"4`0`Ѝp@/@-01pMP`H!݈@L0SL0 ^ R0/T@# (!6 0/( :#&(0| 0/ ` 0S @@ @L@\L@@ J^Ѝ@/  p@-PP` 0  ^ @/Lx0S L0!^@ P\dd0P/ ,L@0LS8 L0 ^@p@/8DBR(A-@RM A @0`tP P\\ P/V@@ <0`0!0廄ЍA/3L5@-( MP` 0p0P @ `P( H0 Ϡ噄@$  Ѝ@/A-PPM  H1R @ 818/X P  1a/Q  0p/L0^L v]  o] p ppH`P p00@0@`L0LSL0(LL T]V`ЍA/8DBR@-pP`P M0 /U 0@/V 0p ^d/@ HEH(0 00 Ѝ@/D0p3E-R M`0$(@,Pa 0tW 1/00 @ ˠ` @0S00< 6R!KC R3(0 R H`X$  0@$@1 ($ ( R\B@ R R@@T0Sw [. ,@aѴ  h a @8L{a  0]jI[00Y0,`S[0H@P p倰 6/ R 6 %1 Q$ !$Q  KR0 0  T0S0 T& P & 0 CR t Tp3Y\ pIGp@p{ \ЍO/s ,. P  O-,4 MSP  1/ :# p` @P|!cT$@ p5 6RKCR+(0 R  H`W$ %!p(@(@ 'Rqp R1pp p @TZ AT / $$,0T@4L@0CP88  T ЍO/ t ,.'T PO-BM M)`(p .3$0S R- (@$6 6Ɵ/(@!FT(0^| 6tƟ/ AR DT P6<Ɵ/t3( 6 $ 6Ɵ/( :B#&R(0p(^PH$@P`P 0U0$0 i@T  H00LXLB H%$DtS뀀L NRL $$%jSH 5T/$P `$`@`%0 S  Rx 4pğ/P0^ !` [`  @T @T 0Q 0A?  P@$@$ P  0@ S:^: R` \^Hß/ @ TT P3@ R  0P0$0  P P$PU{0S(( R| 2tŸ/0CPD P2<Ÿ/$ R| QyTX TDPTGCPP@"Rt3X) (^PUEaodP (+@帶!0pl ڷP+ @喐!0l ( >Pq P L1/0 0Rpp 0 pT^ X PIP \ ARTQX P TL 倀,ЍۍO/-4P8  |A-GMTp Z% ``pl 0Sd0Q 0(0AS(( 0Q 'ЍA/,Pp@-'PR0/ @T0S o$}/4@\TT T    }>⩳@T @p@/ p@-'PR0/ @T0So$}/_@\TT T    }>u@T @p@/ G- @MTTP``0SUڱ` `  }>?@P$}/0E@PT@ @ЍG/0@-@PMP  0R  0/LPLXdd *Q0SbUL LRL ,, QЍ0@/8DBRO-XMU`d 1@吰0!Pk@T00PPPPP!P@P WP(00!Pw `P J$;^P 0 P0C^ P[  ( 㷏P\|| PP0 P,TT P00ЍO/@8  4hP, @-@ MPPp00PU0`S` S TT P0P/PpP$00 iPPWЍ@/4p@-PM@` @0PSQP JP@S 0|// @+88⬰L H(08 w800Ѝp@/40@-@PMPP 0 | ^ t/wPX X@P厯@P40 OЍ0@/8DBR 4-<MR\  ,0Q:# 1S R *T DTЍ/O- d q6$PUW- [t 2pŸ/ R0P PU$P <2 Ÿ/ PU`$`p`( 0R(000$@$`  , R [ 0 S4``4 80`=SQ9 $P/ @\0S \1PP 8#8S.S,8/SS S \ 0S1PPPh\ l0  P P PR<ЍO/eC hGA-M@p3 00@ =P80Pu=PP@`U P@`` /0@PP `=P P@ I@PFC@ЍA/x@-PP M`  l1R dd `1`/V<H D18A/pP   1/LQL $Mt0 0@/t   0/t0L@DPtL\ M dXp@@H 0s Ѝ@/8DBREFtHJLMR]G-`PMpᰃ  1R || x1x/WP .WXPPK H@P@F  Y (PQP$P 0  P P0P, p! `0S0 L0  @@ PPP2`*"@ 0@S 0L`` LTYd@ЍG/8DBR\O-pP4M   9R   9ɟ/ P( , P8H/0@CT@ R L\L|(9L Q `| x8\ȟ/L 0BSL0 ,PP(LYL 8 (L $P Q `V 7ǟ/0U  7堗/` R pj7pG/@Y9\ 0R @T X T7ǟ/ P00 Q   7F/00 R 0 0 \  6F/  0S@8( 5 R.X00 \ ` \6Ɵ/Q 0 0 0S  6ş/  ,0S @,(@ ,@@TY@Y@   R  00@0 0Px|0 R  0 ,5ğ/Q  0 (  0@000t@U5 Y @ P  Q| x4 ğ/ 0R Y( K@)Q@  R    00@ \@ T 0S < 38/$@@ P00  R l h3Ÿ/Y 0 0 0S $ $3Ÿ/  L0CQLPt"J$ R\ dT ^  2/t20H( 1qq(Pg PP88"J(PQ@`"  ; `V``P!nJ!|Y$ \0 S101 ^ \101 RQP(00(0 B BPp!6JQ PHL0qPU+P $ #J004ЍO/8DBR( 0XC@l| (T(h2,?PBDG-@PM Pᰣ  2R  2 Ÿ/U 1a/ P  p !k ` 0S0x!IZ 8$ P.0S 0S19 R U  SZ0P RZ 8 0U < 0" ! `0 CR Xtt nIY  Z 0SPЍG/8DBRo\O-kM MNk] /P ʀ >Q \>Ο/~k`V $ H  B$X>k͍p H``F] H @PD$@Kʍz$Hp $(,sU= CU`~k-PPHBk=@P]P,-HkM-@P `@:k]*0⿯LPPB( @,HpG,[*7(Đ\ k]j JP pj&ˠ` 0S0L ,H$ H0 pW\a<  R8 b pʠ,;` (`NP @@,H jpT_M:(@;b͍`Tb8 [CU 0]Pk  !iB(`H p @6T_-( 0]PjUW^pGU*͍0(@CzZ呫P P@ _](k=!PPaʍ: r`@ k`^( +(HJ*H$@ PpW1 @TLQ D* HT *} _H(B@( P- idZkm$@`eT̍8aTf- 8[T ,XTp[=( BI8@ }T,JTPM {BQ͍oT ,$@$P(P$U H1H@PPL  Z 0 !1000 0$0(0, H40S  R, (1/[@$@0p0@(T u 3(\ 0R0  HPT 0G" !;` LR  (X@ BLP,ЍO/8DBR\Cm`@-@PM`p  0R  0/H 0mPP' @hL 0SL0 Bt d| x0`/L t0BPtL(HH BDPЍ@/8DBR&(258P A-PPM0 `  1R  1/H!1l@Pj   0 S &QՐՐ1Հq/  0S0Ld `1H/P  44P ` 0 0pp"`p! 0S0 )B( 6 0p/( !&(p 0l/pp2`!ˠ 0BS0$dd B(@ЍA/8DBR35B\CiSNDXR\TUYE-`P MP@r  1R  1/T 1封/,P,x  (ˠ` 0 ^ Xll!AW$ @.p,0Q K?CQ01( ( 1  0S S S Sp@ RT 0 ,0W 4 ,0 BPLhh uAT QDD0  ЍE/8DBRo,P43@- @MTTP`pp(0SO:ῡ$ }?◣xPP  }>+@P P 44 000/@ @Ѝ@/M@- @MTTP`pp(0SOOს$ }?♣xPP  }>@Pc P 44 000/@ @Ѝ@/&A-PMP`  P1R HH D1D/  ˠ`0^  !@(0 *"#6 $ R @ p 0@T W@ |2 ʠ,  ` 0BS0 $HH @ЍA/8DBR.1\HPE-BMMpP `  |2R tt p2pŸ/P  A @T& A z PU00*R'RPX 1 BZ+AP@i!0@PZ  ;`@T@h!$@$@?0 KC R!X((1 , 000!8C0%Z   1 !((X @ 0 QX  L0Z@T2 ! ` 0BS0 XX ?$ЍۍE/8DBRT\d8  \|G- 0@S`pW XX T2TŸ/'R0<<20/PV  Q}$0TPr R ؁^ .+` 0S 0!z?2`!ˠ 0BS0Hhh!j?ǔ RZPC @^N  P9 `V6Ȕ (W2` ˠ 0S0 B?( 6 0/(:#&(0X 0T/2`*"ˠ0AS0P4 ? G/ E-Mp nK NN0`PC@AOLP M0P uPP0 `T 0 PE@:0ЍE/O-PPLM0D  3R 3ß/P*K *}P#>p`p pD 0ᑥ@P@K  }P8HH#>[<T@ }P#>Dp @P!D=D@\ Gˠ., 0pWLP @P p}P XxT f}P 0T@"^>@D` ˠ  0S0"M>D^D r  ! 0\0T0S=D0S  :#\ ` 1X/D  :#D R00" ;^  1/D  :#DDTD  :#D`*"ˠ 0CPP~ = |P0p@ =D0@0LЍO/8DBR$\@-@Pp`P MTT P0 H ^ @/`P H 0‹ Ѝ@/i8DBRA-0CM`  P00 RQ7ǟ/ R p/ t7lW/0SZ pW8H D74ǟ/0@S0  7V/ Q00 pW  6Ɵ/ P 0 0 0S l 6hV/p 0  \ D @6V/0vH( 5pd p40Q-Q00\  5ş/ 0 ^00P H| |5Dş/ 000@Tp\PW: ^Pd000\_ B.;吡!PJ0S 4T/PU+ B@cT">P@@B΍B>0@TO-P P#0#<$<#A44$0@V@ QH, $ 4@=P A⍑P@T d 3`S/ PN<X @O P B +mUl2D3 `C A<#40xV@}OPHPP@`^Ÿ/`|0S0"0?<P @\ PU 2:PU@@\ R/\ T |2:H!1 M@bQ@@\Q/\ T 2: BHh1!@b00 R@rA@\ T:H!1bh^hbI\ 0H`0@b`@P {pPU  D1@/ RLP0L0l6 !;AP@<PP80H k p@CލA/Dt@h@B8  $T #5 =lGISZ<'O-` `!"pw`Pb0@x0|@0@0@0@t````@ 0P^PpQX T2Ÿ/p NRp  , (2/ p`a```0 0  l0PQ\!81` R@0\h?\ T@h!0`Q \ 8!0`h0ShKG \ `l0`` xL\0L0D 9 $0`` <ЍO/*<  JLXdx  x XK <DSND8DBR < @-PPM Mp  1R  1/W P 1A/` B` ˠ @0S0Thh!T9 0``OP Q0`S`` LR !99V. L@TL@ -9Ll 0L@BSl@L0 "9T@CLP +R||x x0P(S f Ѝۍ@/8DBRHx 8 0@-@ 0 MSPz ],  H 0_ Ѝ0@/-(0 M$0!G Ѝ/A-@MTM  1R  1/pPʼ 1Q/pPAUpP\`VZ$pWU$`p` 00S 08``( 0BS,! 08` 0 PS`\W!p:V- LPULP  o8Ll 0@PfSlPL0 d8UPKP +^Q|#xxt t0PjR 00ЍۍA/8DBR<zx 8  O-cMMP0,ƍ  4R 4ğ/P  A E^G.O>` p0  $0(`8dPU HPV,6$ uP!`01,FP(( a  R` 0R` ` @TY NX !l7XƝ\ ,y,6X0`, 6Z dƝ, 6! Z! U 0CP00 <4!=7^ !57 &, Z  &* 0 CR  #7P!vP 7<ĝ\ h 0d/0@⅗XߍۍO/  8DBR,,.XPijuxzO-MMP`@ɍ8  :R :ʟ/T  :J/ P r R@HpJ΍G^@pD Ld$< X$\$`$HC M1@PBC@E80PH8zP@v uP )68pP @pn 0$*n` VH0@ `!#-ɍPB> 1M C@go^BPq 1BP ΍B 0J`P虝 80!+ ` @pW4@ p(C6pi$@`6 R KHR-( 0S8 HPV9$ 8@!i(0(   P /Qp Ч Q` @TW m0$*PK`P  (z80p;Y ,ʝ 80288g9 *0Z` P@ ᥘ`4L^&5V  RH6Vc ddV @pGp8@H. AA%`PVNY 㸂8.;/[[`P Y &5 $@.p0pPp(` `$`,`j :R"KC R\y(> R8 HpU9$ 8NpJ1P !Ip((@Q9 R [8XR R Y# ,^P$#0RP$P R R RP P ğ RP(P 0S pTRP,P PPP@TX `BV`Y <Y 1SS52 X% JT 8 ( @68= `(1PP\@&V ,08( -(!@cH IH^  #4 Q 8ɝ 0 Sabb [[ R`V  [ RVD( 8@6Q$ PP\@& ,08 $A @ b@W \ 0NS000 !p~4 R X|!v4U @&< T @&: 0NS0p^Z 2Ÿ/,X,@ 0@:#!@TY6 ,0PŸ  R H 42Ÿ/ , (0(0, (PZ 1/,X,@ 0@+XQ PqP ``!20`  @@ ``p`3 0@002  +` 0LS0 k2X PhqPd a2 RQ d꼀 ЍO/8DBRP:Rh\8dE-1LMS@p@Paq ?P Qaf p`PaH ``"喜0P0PQ`SS @i>D寑D@\ 2 ˠ P !"H< @0PP8<@ 8 4 D @0 8 ^ 0/0/@/(iSND0@-PP@M 0K ^ /TL 0t x ^ d/@PM< H08/0 /Ѝ0@/(iSNDLRSNDЊ/,0 0$RB4 400 /00S C 400  $04 /@-@04000@/,0 /0@-@PMPdd `0`/0 Ă04\LdЍ0@/-MЍ/p@-PM@`D@P @ 0P@RPPЍp@/A-8M@`P pp40400p 4DT0u00  00 mP Q QP@T `4 0*8ЍA/E-$MP@p` @0dP0  <P ʰQ@U 0P$ЍE/Pp@-4@PT`MP L0ZH/0!Ā 0QЍp@/@-@ 4TU@M0  0` 4DpT P0U@PEЍ@/O-xdM@0@PTs((8P 0 Q  3 /[T  2࢟/ \$ pXp\ 0D$RT @ Xh| x2dB/pX'"``0 (0``X PX 0(oP 0@@V`\ @`p(P0Y @ X@TWQ XxN @!h1YPF  'p P\ $P \$`p0 (0{`X PX 0q(!P 0@@V`\@@g P(P Z U 8d `04/ dЍO/!"*,CqHO-(UtMH@ 0p50帹Q㼙 P  4d/ QW  4/ P @,,l@ `hl@ 0 PdX VXh  4ğ/ l0Pl0@$0l0\ (P h0@0 $d h0d`hO  `0SP  0 @hd0P (0P( `Vh   (0U P U PU#*t"2~X P   0@ p% P,`\l`P@ <2r/l  H0c (Qhp`$pS 0`Oh  0R  0`P$PU! (@W H0;PLPMP$@H $$0`S'*H@XO0l  &504P0@P 0w( pW`*0@@Oh  0  0@cP$( WP!@#@3: 0V <p l08/00tЍO/8 %&h5CH HE-PPMp 0(@b/Pp\ h0\/X 4 尡ᲁa$00,!$ ( 0 ЍE/D@O-$M 0PP U#*00"0W`P~ /P @  o\/Nf@@~3Y# 2P 1^RYO  d1 @ pP RP00pG@P Z b"W@=P䰟)0@ 03WP  P @'$  pP   0@0 y ZP@JϠ 0S $ЍO/:` H@-@P@@ <0 4 ^ ,/ !@/ht!uqR--4 M0$ P `FЍ Ѝ/( @-(@88:@/0@-@P MP 0R  0/U P R 0/,Q  0/0^d|| B,  @ @R 4TT 6, @ 0 Ѝ0@/MuqRhGIKN\0@-@PP M 0 ^ /UG 0 ^ x/, ^L``0P/ @000 0V Ѝ0@/hMuqRp@-PMD 0S  0/P  0@/Q00 +`8@ R0 0+`V@$^$'(0S('@X` $0~R[Ѝp@/h8p@-`PM`` \1\/@T @1R $4 01 Q/P  !h+ ^ 0/ P0B 0 P 0SP,Q X\ d 0`P/PP 0BS0(\\ 5+UQЍp@/hYMuqR[]0^`xfi0@- 0 M@Ph R\\0 ^XXX/ Do 00 @ ,P Ѝ0@/!uqRtha0@-@ M V0003(PU$0$0 4P  0/ $4 $^(0(0 00S tt x0p/(0$0 ( @jP R Ѝ0@/4hP|p@-PPM 42R ,, (2(Ÿ/ `P`)Q ) @T *(^(&$0S$}&, R,l4\4(8P8R>0@TK t^ Th d1P/0`0`V` <0@-PPM R 2R  2Ÿ/@ T0Qhxx")0080 R 4LL") R000\\   2/0\ R000X0S  1/0X 0    l 1h/  @t p1</0 80NQ88!)00C^!}) r  1/(P  0/$Q d 0`/,^ 8 04/00Ѝ0@/!uqRhPLp@-@PP` 0R  0/ R0/ z4'P8@)P  0P8Q 07@p@/!uqRht$D@-@PM T1RG  DDD1D/4 D  ?Q  0/ 018 0 R  (hP  <00! }h0 18 AR @\\ (,, (0(/Ѝ@/!uqRhyth}0@-PPM 0R  0/ P l(,0S0X@,0 t@T R X^ P` \0H/]AP, I(Ѝ0@/MuqRh0p@-@M`0PT 1R  1 /U 0/00P (,0S @ }0!} 04P(04 0$ (4 LR ( 'Ѝp@/MuqRh00@-M@6 P@P pZ 0PP0@S9 [  *Ѝ0@/@- Mp0@RPP` " ,0<0L Hd`` ``` `$`(`,`0`4`8`@`D`PPT`X`\``h``J(0 0PЍ@/h !!uqR@-@P 0R  0/ ,Q ,X(0S(#  $ ㍠  $ ㅠ$N#@/!uqRht00@- M \1PR@ LL H1H/T 0Q $ 1/  1/ 0080 R  '   , R ~0!80L^ HH &>' Ѝ0@/h!uqRtHl@-0  Q0@/018 \l|& h : 00180 0 L\,, &@/!hnotE-PIMp`@: 0N0$PDt0 *PP`V9t$@t@| 0u PP$tPP S@K@:P @|+PGW2R tP P)$(P0P# PsP P _ ʠPHPɠ0 PI'PPIߍE/@@-PMU@  \1R TT P1P/ @Q $4 01 A/ ,Z,0 h@080 R  % ,@Tp`! $@P$@P\$ (2"V 080 @R << %Ѝ@/!uqRht#=A-MP@p `᯹ ڶT@@X 01ЍA/A-PM`p U |0|| t ^ l@/$@ H0 ,P 00 0ЍA/th!uqR 0@- M@PT 01R (( $1$/ 0 80Q ?%0 ^ Lr l PP   0080 LR << %a% Ѝ0@/!uqRhEtJYO-`PMp 帢R̲ 8R xxx8xȟ/WX7 X8PH/X0< 88(/[ 8ȟ/Q"7G/"R P  7圗/2S t7pǟ/Q Tr@QrT 0` \7(/H 0P0G 2@P2s3U^ PP,  0Ã@P42 &B$ @T@v y @0"^ 0  P,0R8z3P0 $@0 0@@PV"$P 5|ş/?(@@$ 5^"@P:,U 8K$@P/2 "|" P ,,5D/g  %"@P^ P q @PW"O%@PA &@P; &@P5 %@P/ %@P)f'@P%0x"0P RP,DP0 y"@PU<| !|"@P ,"|" !PP\ "|^"U T P2(B$CT" 4 @PQ#w#,^ @DP|"l#@0FB\0"S X \@@"0LS\ 0xp"M#^", @P$"l| P  2PP 0 0  P"" I@\$!#"^00 \0S ? p1/"\"Q00 X^ ? $1/0X02   QP "Px10) ?ߍO/MuqRohLqrXsuLwXD  :0\! (TE-,MT@PTpP`  HLX\`d 0 @ ,ЍE/-,M048 <@DH k,Ѝ/-,M0 004 8 <@D R,Ѝ/O-PP,Mp \` 6R 6Ɵ/X 6F/Wx 6pf/ZP `6HƟ/d R(DD6$F/l0S P  6e/T R5ş/Y o@oT  5e/`Q 0PEL  0!@PFX~3[Q TUPX <%谌  ,0 0 0@Ph 4d0$ @P)"  @T@ 8w    00 @,4 @RDP P $@0@@P $ P  4ß/ 0& ( 0$ 3@P@ ' @PX ` `I @P 0|X Pd `3B/ N  ,@0S0#4!,0S @DPt")!@ 0 @\ RX \@@ 0 LQ\ ld" ! XX , TK@P# 0l| X  2P    QP L 0l0I@^$!  Q00 \\ p l1/ 0 \ ^00 XP  1/ X  0S0P   Ru & ,ЍO/MuqRhXLXD  ]0 \! %(T&E-$MH@DTpP`  ޵@ LPTX 0@$ЍE/-$M(, 048<$Ѝ/p@-M |1PR`@ hh d1d/T LQ 0@ <1,/    1/  l0080 R      $, RLP ^018 NR LL  Ѝp@/h%!uqRt@O- MD`p048< R 0S  2 Ÿ/X 1A/V 1/W 1A/[t 1l/Z .P 8 H10A/Y P  1/` 0I@P, 00 0PS(0S $B( @  @(B6BSx x ύ0s7@Pb<0$rpB|BxBtBb@PM|7|<G7&@PCxx$ x408xx|"@T  x2||B|"x @P#txt@P'\@Pp! p(pt"(0@S $ pt(tb @tpr(pDtP 2x2S2 |"Q00P 88 434ß/|2x  |"Q00x P  2Ÿ/|2x |||"RTv SM x@Pgp0 60$4tt\KPbF p@ ba@PN >@Pg @Pa @P[ @PU @POU@PKD9ͅ @P lP: 1A/lO,\ 0&`dPß@P 00 0"R2S)(QP` \ x   wDT qߍE/dXDH @-M@,`T d1R \\ X1X/H Q (8 41$/( 0@R0 i4V TPP* pᒨP (0d .a P\志P? c0p "`\/=td`P < Ѝ@/IrfXX%0@- MP@U0  ^ / 0Q(B/ 0N 0,@| T0 @P$ $  4 Ѝ0@/XIrfX\U p@-|4GS@m  xPP$R )PPx|$p PP Ĕ\ 1PP p@/0@-M@PP|4S Q ,PPG  xtgЍ0@/G-QM  P`p0 ^@P  0/ @P  $0dS4ښ@ЍG/p@-M$P`Pd p@/O-DMPU<4 :R  :ʟ/ Q  :ʟ/Z$( 0@R$0dp@TrX*0n@Pi< @Pc<&@P^<[@PY<ĕDT< h00h0< Z@P <@P\0SV RR HɟTT @PPT4P0`)<@ T  < 9ɟ/ )\1SWQ- 1 @PDN~-ĕ\ M>xyDtQ =tD|$RG  xD6S ĕ\ 0S 0(S H `Q @P {P0'l<E^<8 8@8@$Q EKp 뤔8p $ĕ \ /hY H` Y PZ [ [ \ t\ ] _ 2S,'?DdQ;WP 0$"R &%F)^4c\"WP&4FkP0\004}FT+"R(DT#,&^ &xĕ@\D 5ş/04PPH N 0*p%x@QDG%G>@ 0l, @PM xT@P$ Q , (5ğ/@ 0@+@P0BT DI 0:P 4 40ğ/ 0@P0t2S$PS4P $hA@PS*P 0@P 2S%Q R`0`` \@P0@ 0@P @dTD@P @PM΅x@Px t@P x\ 2XB/P Z<P@ Pb<4#P $R=d <+ @PO<:P ĕdPDDTA $ R> $`dp@`p0@4D004Spv@P#> Sĕ\N.+4S /0(0)0(!@P$00$0  AA<P <T  004ABT` 0@ sDЍO/IrfXX4XAlN$,%TpYp$BX\U -@-@MpP`]0S S 0 PP| $d/P  $0pЍ@/X[X@-@P M `0`(\/ ^P0 \'"SS Ѝ@/H<@-$@$0 S@/`@-@^ 0S Q1"\ @/Q? Q$ QQ' Q  QC Q@ QQ< Q: /0S8;1 P R0 Q. 0Q(. $R& + R 41 P R 5Q )0S.' R S Q  R  // 0S Q P 1S0 Q P G-QVMpP 2Ÿ/ܼ  tPakSN `,  0 PPL|@PD V.P"\>P"0P ᰼0"᩼P4 P/ P*P' P#P P P P| Pld \TD9@M P-(!X 0 Q,T `U~A+pX[  0~PP  X%0T  ZVލG/p|$4D0 lA-PP`Mp 0S P,@0N5@ V,p` ЍA/pO-TMx`Y p 3ß/ ` 4P @P4@T80P @P40S8vQL H0PLPH@T4P vP@ P4^ j@P4\|8dnPw  \@Pu4 Rn8`呻Vi4 NP@ Pd40S` 4 @P@D PW40S SO8Q ^@ P0 #Q PS> #P;0 8!T1 8P6 P, W @P0@@@@4 P@ P 4 R` Vڰ`   P `  @@x@``  `L ,0U4TЍO/p|L0w///////--4 M0$ P 'Ѝ Ѝ/@ @-M@0 uЍ@/0 0  /FFID RX 0T0 X0 0/G-PM 2R  2Ÿ/"2W7PPpb@Q h |2dŸ/@dg8`|@@r<@@. P`@0t`@ 0 P 0! "@XP@ _ 0 @e\P@ `1 qp3  #  9@P 궤<$)$ ἶ$p&80`p4xtdtt|d-#I M0 (8pDX"^Q0L HŸHI΍͍p @$x0Q`x$tdL P0xdXPU  6<`0pPpG @ T $\ P+ Bn `F@PE ;Z$ 0 @@@Z0 @ 1@/@P \ 0 0q$TT TU P^I. UB@QI΍ ЍۍO/FFIDDDSNDThP 2X00p@-@`TPk P0P H ^ @/ ` n0Y0`p@/LDTFIDp@-PPM@ 2R  1/ R Q  1/00OX` lPH <<PA08 8 R;X^T0T0  P , 41$/ T  T^X0X0 0S  0/XTX0 R u om`0S 0S \X00 T0X Ѝp@/FFIDDTFID @-@PM 0R6  0/-XQT0T0  P  0/0T  TQX0X0 P ` d0X/X  T00X  R Ѝ@/FFIDDO- M4@\0 4@010 \ Q/p`\H0 2PP\` p<0. ]^@`8@ O* * 0dSLb P0X<@LPT,/4 0P ЍO/DlTFID- M 80< Ѝ/A- M@Pp `ݙ᪜@0P ә0 `/g0 ЍA/O-OM pP00!$A 3ß/XB 2B/`1S C2R/PʤD 2圲/.|p3"|MOP P[  V W`00u3P.P`,a %|@P Go   PPZ0f T   K?P<P]@h:,9 V`!PN @ fZ0 [01@ 01 >\ 3   P h  ) P0A`0S SS U U|`|P@pTXpp0*`XOߍO/,@-pMd`P0@ `#P:00nЍ@/HG-PPM P 0 NBAAPP B P`n1#Q ` 01Sr@ @r v Tp` Qr v Tp`v W`@Pv UUU:00!U :UVW WD R P0d LrP! @ 0!@PUv PU2PPPPa ^  yaPЍG/|-P 00/ Pp x ` //// /LX`hA-0M`pPR І d@@X@T@P@P H0e Y 04QLX`hpp@- `MV@OhQPJ e R 1 J@P> @Q;  0@R@S5P5 1@SP,-``@^00`@2N!"1Ì 0 U 0SUe  P`@^ `Ѝp@/p@-`M@ 0PP Ѝp@/E- MQ@ `p2 0#P20P,2P1 ,P(0(0 (Q  0@/((( R,0,0 $1S  0/,$@T,( ^H J?@@D  0 0,Ѝp@/!xeL#*p@-PPM@` ``0` X ^ P/0< b0 `Ѝp@/!xeL$p@-PPM@` ``0 T ^ L/08 <0 `Ѝp@/!xeL0p@-M`PP x0x  h@^ `/T @P  0P@P  Ѝp@/!xeL|p@-`PM 0/@T 0R  0P/ P l$QU Q  80y PPK/0pPЍp@/<!xeLPA-RMp` 0S a 0/Vb 0P/K d0PP#  g0P iK/d04@p`@@ @$,㛭,$A(APЍA/h!xeL@-$@$0 S4@/@-@P`` \0 T ^ L/ 0,Sj ,0$/ @/ءxtcL0@-PPM@ 0R  0/T P 0/ R@ 0 s Q@   \Ѝ0@/xtcL:ء;0@-PPM@ 0R  0/T P 0/ R@ 0 s Q@  \Ѝ0@/xtcL}ء~@0/@-@P88 40 , ^ $/@/ءxtcL0@-PP@M< 808 0 ^ (/@Ѝ0@/|gfcL@-@P>4 00 ( ^ /@/xtcL@-@P88 40 , ^ $/ @/|gfcLP R 0Q/$0S/ Q//0@-PPM 0R  0/Pt  0@  R\ &(@T0CQ,, Ѝ0@/xtcL ء T0@-PPM@ 0R  0/P T 0@@ 0S   \ (@T0CQ,, Ѝ0@/xtcLءT-M Ѝ/0@-@PMP 0R  0/U P Q | 0 0X ?0p03 Q , 80 0 0Ѝ0@/gfcL|E-P M R 3R  2Ÿ/P0S P 2B/p?(X$0$0  ^ t 2pŸ/$0 0$ R(0(0 P ,@ @2(/(\($!?JP-!1B00A, 1@@T7 R00P `" 1\/0 R 0 0P " 01/ 0 00A 0@ @0T Xa1:R !t0} @Q$@ L 0 @x @@@@( 0e@ ЍE/gfcLt  Hl!'+1A-pPM R 1R  1/P 0S0  P006 4@@!G1^ 0 0 $a0S  1/  Q00 `P  0/00 0忪@ h0@x @Tt$@@@ @@@@@L 0@ЍA/xtcL( x$ , 0@-@PMP 0R  0/Uht p0d/@0s@ :P @ R@Ѝ0@/xtcLء*0@-@PMP 0R  0/Uht p0d/@0s@ P @ R@Ѝ0@/xtcLfءg*O-pP M0 2R  2Ÿ/Z 2|B/@HTT `2PR/XY  R002b/{ 2/40Q  1Q/ ,`1!PP[  p!1PϠ, H1J 4 ($T @@* (1 0  0 @ᗩ̠ 000, \0"@ T$P@ P$@ h( PBPX0P ЍO/gfcL|*,\G-Q M@ 0S  1/T R  1Q/(x!1PS @@P@\Qp@p  @$0 0 P@PP,0` P Pp`PP@0 PP@p`PP 0 |PPPP00 0S P ЍG/OlxtcLءRgfcL\]O-M4MP ($ 0VF >R  =͟/(Q ( =͟/$ R =͟/ 0S =͟/T\ Y x=X͟/YI (0 P: H D=͟/$ R:  =̟/ P* U0@ :&0Y~0@&,@T@Pp , D$@(0 0|03HH0|03 ! D0H<H\  HRHH 0S $ S HH `H   P 0S0 S S &,PU @ @D}P8 ||+h&̍@ | % &T0S! Pu <+ 4;4+} 0  \+;倨 0ʟ*0w$PU$0 6_ &R D} @ p @DVz}P ll* ^{PT:@I 8- 0 CzP3PU 0 0 zP  :ɟ/  Q00 y0S D  9@ɟ/   儧 8@ AP0CQ+ D@Ti($9PP @䇧}P`(8ȟQP 8P P 04 D 0R0,0!0 P8 <@ PT P ^ 0s-8 ⪦P Q :œ\@宦 @@@T4^  K4L PW/00GPP .ʍX5SC-0P0SM.[, lƑ0s3P^PM @K-KP K0@sA p pSp9@  P0 XP&P0 %0@ pGA 0PPEW% 0@p P$ 0@ P0% 0@廥@A͍00CpTPN 0pDxx$ R 0`$徦 P@0 WP&P0 %  0ᔥ WP&P % 0㈥ @|%0 〥 p L wPpUp:UU   @c% 0xg 9 0W  4,P^D3&,  83UD8@$S  ST(<CCX$@Q}rp$  @p壥 R]P  02/=8 -PI  Q0 0B@ pW z 0࣓24P,@U1&,1  TD8Q QX(Z8 r2>TPG% 㸟X Zp@/A-`p@T05@0205?0@PcU@e@ e@ ᜟpeP꒟@P@pG?W@  ჟA/L0P $ 0 QP L0,  0 2,$ "2‚, "/0@-P0@SPM 0551/1P$ eUP,02xS |0p/,$ 2C “8\ @00/, A"Ѝ0@/T\p0-(((0 @P 0 0/ (@-@P88 40 , ^ $/4@/TCmeM@-@P88 40 , ^ $/D@/ TCmeM0@-PP@M 0 | ^ t/ \HXX0L/T(@ <0(/@Ѝ0@/T,pMEM@-@P 0R  0/ R,@ PHTT  ,@R 0LS0,, @/pMEMT, 0@-PQM@ 0/T 0R  0|/ R PD\\  ,PR 0LS044 Ѝ0@/T4 pMEM, @-@P 0R  0/ R @ PHTT z @R 0LS0,, n@/pMEMTw,z @-@P 0R  0/ R@ PHTT G @R 0LS0,, ;@/pMEMTf,in 0@-PQM@ 0/T 0R  0|/ R PD\\   PR 0LS044 Ѝ0@/TU4 pMEMW,Z_ @-@P 0R  0/ R$@ PHTT  $@R 0LS0,, @/pMEMTF,IN @-@P 0R  0/ R(@ PHTT  (@R 0LS0,, @/pMEMT5,8= 0@-@PPM 0 ^ /\ P0SXX 0m(P\ 0 0CS00 0aЍ0@/T,&pMEM). O-@PMP( H1R @@ <1</[*$ 1a/pQ ,U`0``PdPhPXP\PS` W ZP 0x03R`!`3`dPhX\`0CQ0LL VW /ЍO/CmeMT@ T  0@-@PM 0R  0/PPPQLXX 0PP LR 00 Ѝ0@/CmeMTT  0@-@PM 0R  0/HPPQLXX 0HP LR 00 Ѝ0@/CmeMTT  0@-@PPM 0 ^ /00P\XX gHP0 C\00 [Ѝ0@/TCmeMT  0@-@PPM 0Z ^ |/00P\TT 3(P0 C\,, 'Ѝ0@/TCmeMT  0@-@PMP 0R  0/0QXdd U U`P @\,, Ѝ0@/CmeMTT  0@-@PMP 0R  0/U P ; 0/ 0S0Tdd 00 0BS00 @Ѝ0@/CmeMT \O-0 MSp< @9.0 )q ማ  0!q QU `R  0 0k V@PU@`$XY( 808 p T ЍO/,!\! 0!0@-@M0PS @Q =@T  -@TŚP` \0\/, 0BS088 Ѝ0@/ T!!X!0@-@M0PS @Qttt p@R@T H, 0BS0,, Ѝ0@/ T!!!0@-PP@M ``0` X ^ P/T,< 80,/Ѝ0@TCmeM!-M%Ѝ/A-bPMp` 1@ !1/p( 0@P剚Pc $ W 1q@Q PIa1  CR  :   TT P1P/@Q?^00 0S  1/ R000S  0/Კ Q@T @X T0</ЍA/!@0T1"5,"T"B|"p@-` @RPD0D @@/ ^ /p@/"T0@-@PM / @P000CЍ0@/E-pR0$0WM@ Z`0P13: , /$, 2S@ 818/$ ,0L2LW 1/P L0ggLP/`^/ U 0P: | !|0,QTl h0L/, 2C,  0 0P jPЍE/T">")"W#A-PPM`p 2R o 2Ÿ/Vhp l2`B/R P,<<"F ^( $2Ÿ/  @ 0Q!-p0 { 0BS0!$(QE:0 Q@p`!  & 0BS0! 4 Q  4 0BS0  P LQ\q0$0 `R LQ XX ЍA/pMEMT,)#4#`#   E-@P MP 1R  1/U 1a/`pE pE^ \t p1X/`0  0S044!m  LQ Y  0`PU \ P\:Rd 0R`0PPLQ0\\ 4Uhd/ ЍE/CmeMT^_(c#kT o A-@PMP`p  1R  1/U 1/   0CAQ l 1h/ 0ЍA80  ^ ,,!  0Q   0 `PU \ P\:Rd PRPP0CQ0\\ Uhd/ЍA/CmeMTkl(t#{T  G-pQ0$0WP*X :H R L0S /@P; L0P$,LP‘ ",$0"| @T R`H xR  L0Q@T 2Ÿ/Qk /@P0 R !ݖ /@`x /P0@oL@ L x`00  x`?Q0 @@x 3PC:R Q`x@om,  0@h,0 0 0@h @R  | @@|0,  @0 0| `|@00,Ž, 0," 0N 0PP@ G/Tn#0@-\ @0@MP  P 0P@Ѝ0@/-QMyЍ/G-aPM`0 1@ !1k 0PY R[ $ Vp1 p!a l  R 0 S3  Q\0@@P$ 1/0 C  P:   :p 0R@ t0 |0 C* p @00  @ЍG/#@ @T|" 00E-@P M 2R  2Ÿ/DR PLXX"P 0SP#Y*PU $ \  2Ÿ/0$0  0C?p PUP!p PP 0P Pp$P$,0W:P LR ,,!PU $00 0C $00  R @\ kU 0 R p ^  00 CR X@ I ЍE/pMEMT,$4#`# @-@P MPp` 1R  1/0 Pt!pPk0P R $80!U, 1UP `0 pX R ``VP\0``0`P TR X0T S R0Ɣ @\4UT Vhd/ Ѝ@/CmeMT58T < $ A-@PMPp 1R  1/  0ЍA[0 `V`t!`0` R $<4!nV 1VP  0X R `PUP\PPPP TR X0T S R|05 @\4XX 2Uhd/ЍA/CmeMTAGT K $\ @-PPM`p 1R || x1x/VT` \1PA/W P 4 01/D 1?@P5  0`0, $ $ (0 4 @``\ p`V@pl@ t0 `p@t  BQ $PP Ѝ@/CmeMT0$,+$!pMEM64#9`#A-PM 3ß/PU 2R  2B/ P "40c Q  2r/p@W ^Pxx"h0% R PP"\$`VŸ/$` L$ 00  a + 1Qg  0BS0 !.\<|l!#^ 0 0 p0S P L1/ p P00 lQ  1/l t 0@t0N\h 0 0D <0W APtt ЍA/TX$pMEMZ,]$b$%i,n4#$`#<%\%P0@-PQ@M0 /\ h0Sdd 0 4ڑ\C 0$0CS(( 0Ѝ0@/*TDJ @-@P`pM4P0  ^ /h0Sll 0p ő ᠑0(C\0 Dp_Ѝ@/TCmeMT  A-`PPp 0 ^ x@/Uh d0HT/ۑ@ 0 @PeA/T0$CmeM8O-P4M($ 2R  2Ÿ/( @Q"(`p$P(,@0`h\$ R LWD" (P  $R$ 0S 0ב $(0p$PWl[Z A!1 dg$Ñ /1\g ,!1Vg !1Pg !1Jg /p1Dg pd!`1>g `T!P18g PD!@12g<, 0$,p `P凑@P,0T0 w[4 $($( 0CQ j4ЍO/CmeMTT %%|%%%|H5%%%%%&W &įV<& p@-0@`P` \XX5 P $0BS  0%p@/T T46 @-4$PM0S07$@T00 C\  3ß/ R00 C0S  3ß/0d00@Pp  0@R 4PP#lP < 83ß/^\ (`Vp `A R` Ÿ0 S2Ÿ/$V:0a/ R000Q @x t2DŸ/  P000S $ $2/  0@T$pW /00S l 1p/(^ `,B R` P,`0 SP1 /$V ,/ @0 /@ T:| /Q / R008  /lЍ@/ T!ql&&(s!u&}&D'h''''0@-PPM 1/@T 0R B 0/Q 00S &0 R l 0h/0N0 0BS0$LL Ѝ0@/T(CmeM"T '() E-`P MPp(> |2|Ÿ/@T `2R HT P2@Ÿ/U 4 02Ÿ/ -  0CN^  1/ 0P R x!K00PC0PL B\G <lB0 ^ @4!0 E 0S0  c 0f0PUx 0p/0 P@0P0CQ ,pp U ЍE ЍE/T(CmeM(#T  ,( p@-`P 0/@T 0R  0P/Q 00Sl 0hP/0 P@0PLQ$HH U| 00p@/T(CmeMT ,( O-M`,Pp(0 0S L D3Dß/W$, (3C/X  3R/BP /PP V2@$0$` b0@4❍``D`H`L`P`T`X`\```d`h`$0(@p ,```l`p`t`|``````` /P,V $" p [:x0$0x /P|> $ !^! $ /P- @!0$@P80S0!A 1QP@P@P LR   , P,Q /|Q /Q /P00(5`  /ЍO/T@(l((LCmeM >!!'-M  0Ѝ/DP3-M  0Ѝ/DP3-MЍ/ 0S "/00 \/ 01 R/@-0@S S*0S\   ^003  0SR :%@/0@-0P S@M( $0$$/p@Ѝ0@/((Ep/0S S0 0S00 R00/0S P  /0 S$ 0 R00/0 S$ 0 R00/@-t @ 0 @/@-t @00@/0@-t @MP 00Ѝ0@/0@-t PM@00Ѝ0@/0@-0@ SPM 0/pQ ll0@^| @/t ͋ Ѝ0@/(((0@-M^P@ ^ ^ll h0 0p0 0l 0p0 /Ѝ0@/(gX0@-@MP׋kPt 0000p0Ѝ0@/-0MS S QࠓQ  0S<  a$&P)Ѝ/0E-PQM@P00 4M010/ 0R?ppP Q9R R5p`p`A T @!Q  P"@ U:u 0x/TXv \0P/ d0  RЍE/(4*\*p*p@-@P@MPp h1h/P P PJ@' 0b\ 9;` .0P6 -P` 0/ Qp0S 4  嘋@P T x 0p/@ 0bP  e 4a@Ѝp@/(|****A-(MPp`@P`0 \   ^ 1 8`0 N 00B(ЍA/*0@-PQM@P  %0/0Qp pRQ Q Q \  Ip3Ѝ0@/(4*@- P M`pp0 \P  0 S@P TU  Ѝ@/0  0 /tSeD0@-@P MP 1R; F 1/2(Q$0$0 P J 0/0$ $Q(0(0 P xJ |0p/(   $  ( 00P  R Ѝ0@/tSeD*+++p@-PPM`@ 0R 00/V1 0/T2 0/@T`6 h0X/ 00P(@@$(@Ѝp@/tSeD*+X+@- M@`p 0 k Pᡉ0 \p"Q) 8 Ѝ@/@-M@P0S)0ĕЍ@/@-M@P0S)#01Ѝ@/p@-`QM@ x0x/@PP/0 S R @@RU@5Tߍp@/++0@-@QMP 0|ST p0p/AP @W @08/X 0XЍ0@/++,@-`P M@ 2Ÿ/T 2r/ p0W Sc Q0000pSXP/ $ 1UA\ Y^ @ T@ p R  1/ @p0S[ R ^ \ p1X/@ P @ Q 8 41/ @0$ 0@0-PPN?0$ 0 UB P l' 0h/p Q p  R ( 80$/p Ѝ@/+)<,*0Ih,|,Y,]T,E-PPMl d1dA/L D1/@T7 Q ` Z 0SP / Q R  0/0$ S0WC V`V X @8T R<D Z 06ߍE/p@+<,,,A-QpP`l0 hh/P 0@P W00 ``+ 00@A/8+-TxdRA-`R@^ 1/0S0 S SPx` x1p/XPa T1H/Q:XpP4 1 / WW8 900@P0 W U00  0U0 00  }p@P `i h0X/ 4m @0,/0  `A/+-0-8,+O-PM 8 ȟ/YZ YM 7W/Y '{ 7匷/[  PU 0 0E$<'\7@P 00 0 7P(7Z  |0 00 r00 0  Q  0000@ @ `R* q\1 00S P R:0S Q( $6e/[ p1p!   0  2 @P4 @T 5|ş/Q`: Wp!P R 0S* WE RBQ 0 S p0000/ P* RqP |  4ğ/Z  P00 0    R000P$#44`P ^[ $#4P$ 3^ @SP $ \3NT 30$ 83E    Z |0 00 q00 000  Q  0 00\.T  2Ÿ/P 0 R*  Q2 0S ,z x2(Ÿ/ `tP P L2/`g[,T   2/ W*0S0 PP   R Q T 1P/` P ```8T t p1/00  0W0*  P2 `P P`@ R 0S l 0h/@ Q @@@ ` P[& ЍO/+3<,-5-:-BJ$.@.H....T,/O-@PM 1/Z 1/ 0R!W00PR p 0S!0pS1 P R:?!΍p0!A@T `Q  KP 0 0c#0 Q P0 0q R  \000 RpWZPQߍO/+<,-/0@-QP@M@ <0_8%%!/!T [PaЍ0@/8/D/p@-0`PU@d 00p@/@0@-PPMN D0DD/@6#(F$Ѝ0@/T/8/@-@@/Q/0@-@PMP 0/U 0S  0/P  R| 0t/0S0H\ P0@/ BQ00 _@Ѝ0@/h/<d\0@-@ M0S0 G \ \PPPQ0 0P 0  #PP0 0 LR   ) Ѝ0@/h/3x/F/0@-@ M0S0  QPP P   0#PP@HH  0@S0((  Ѝ0@/h/x/%:+/p@-@P0SMx x`0p  Q0  b#`0(C\y Ѝp@/x/h//p@-@`M0S0C Qʘ 0/P 0ESPB(`pp U^008L X 0mЍp@/h/x/ ///- M00 Ѝ/A-`RM@p 0S 1/Wd d1\Q/P 4 81,/ Q!E 0S 0pTPU(TPP$(0T0S 0 "PP0p 0 S p |0h/P BQ<P 0P0U0SЍA/h/0XD0x/d0/@-@M0S0TP!  0"3(Q$0$0 T^  0/ 0$ T $P(0(0 PQ  0/ (P  $ 0( 01P R !$! LP Ѝ@/h/x/00/E-SM`p 0S LA D1D/X$!C0PP@@ @ @ p`T@  @ PT0@ P"@P 0, $040L (@,@8P0? 050?S@@@bP xP?@@@T@P:?@D  dxA/P7770@-PQ M@ 0/TI 0/Q   00. Q ~  ^x   U !1 !3Q\ x Ѝ0@/P7#7777O-pTM  0`$0@(P(@,P8@浠 8bf+2T ,@PH$0( Ġ@(+@"Č8P, 6g1# )gK# @[8$  0(  p `0$($LDp<`@`p(H40`p0P,p 0P`@0,@ Q`(!1 "Š4is,<0a'H @p @@ D0 @e @" 0&   #@Hp DPk1$ @.,@0p k;# P4L@WpHP040`<D @  0LP D0H <@  Dp Hp@P0@p<`  @P00  @PTЍO/;O-cM pt!          x| hl `d PT HL @D PP(Q0P,41p쀍p ఝ 0  ( !1Pp0@0AQ8` a$q !7!i Y ,w ,)ၛ4`{Pа嬴0찝pAt10`P`0#P+. x$%aP#ई輠@(~` ` *4  , $` 찝 Ϡ|+Q3$D$ ḀpBP0B_`> F?@P`P%p&쀝 ᨳᨰp!"  0W  0p',lg  @`, $P`谐 `&#8 P%$H(  p0 # $ਰ %4A &P( 0`L0@PhlXA\Q4^F n $BO0  Z 0V/ 耍쐍! 1AQaq$P` HQLaB`耡儱FPaTq~8<@qDx|@0,A,(, 0 \Xa)@1Xq地YX) !ƅln++ɠX唀d` Yჱ X誄iP吐^ᢠ"\vጀ`P,Qˠၿdhp儰|吠 蘀 ( )``Ep#àhP` `&l=!P%$C% Ϡt)&X\0肏ကha)RTP*^_`0 (Ath(ap QqlAxLPXpphXp\lq+h1l Ϡ CVoHD@VN? M0@ha Pl@Px0 SPR_`pp'(>0#@$P`P%@ `&0#p'(Z  䠝XX\P0H 0# @$0 @R?  @X p P` 0.@ !$ " @ `d,=0P[0x1|AN_`V?耑儡RZ HqLhl!PTX\81 p N0p(P`VPN?`0 - @8 $8<80000 @ p$(P,` 04cߍO/9O-M @ H0  A1 p P  ` ' <)D!d̊" 0 @tlldP`!壱  0 pP`P`!( ,8 (hX.Hx0@ @0D@HL   pQPQp a Q @Q a t 0P@~ t p P t @P PHpt 0@ x |0 ЍOG-Qp 0/Y* dPp@ 0P#d< dP D|0`tl@l 0@ #88$H(0@0^G/770@-@P4MP 0/UP  l0 0#"  0P `P 0 s4Ѝ0@/778G-Qp 0/Y* Pp@ 0P#d< dP D|0`tl@l 0@ #88$H(0@@^G/7E70@-@PDMP 0/UP  l0 0#"  @P P @ sDЍ0@/7d78G-Qp 1/YY 1|| P`p!@.p<T$ĠHApD@!0Q#8^ 8,H(0@?a 0$@  @8\()8 l ?\) @ lr(@ 8 r(8 r( 0(`0d@  l8$0 $#  QG/770@-@P$MP 0/UP  vl0 0#"  P @P  gr$Ѝ0@/7 78@-@PT  PMr 0@ D0H L0@/8A-RPpo PQ  1/@ D>0A> `cXP01@: }r@1@ T@D SH0 0@H0L@Ppfbr@;@ R Hp@D  Q*H00@H0L@P@X X  >r@1 0S@D RH0 0@H0L@A/78@-M`P pb   @ Ѝ@/@-@PT  Pq 0@ D0H L0@/;@-M`P p  L  @VЍ@/E-RMPG PQ  1/ $>?0A$ @`cZ(p01&: q 00@ 0$@ fZ qU 0̠ 0`@ 0$@@J@(`?Z@ Z q 00@ 0$@ЍE/7T8@-@P< @ ('q 0 $0@/<@-lM`P p   @lЍ@/0@-$MP   _q  @q$Ѝ0@/0@-@P$MPm 0/UP l00#"  P 8P p$Ѝ0@/788@-@P< @ (p 0 $0@/<@-lM`P p  w  @lЍ@//p@-`@| Pp    &0x p0t p@/p@-P`| @p00 Ġ% 0x p0t p@/@-| @rp40  0x p0t @/@-| @]p 0x p0 t@/-QM \D @0ЍЍ /Ѝ//X=0@-@MPypkP| 0'p0np0p0Ѝ0@/@-0xM@ S0P0xЍ@/@-0xM@ S0?0xЍ@/@-0xM@S0.0xЍ@/@-0xM@ SS00x0xЍ@/@-@P PL L0  "8#,E0 V@/==@-@4\ 4 \@ @0 $ 40(E0 3@/==p@-P`| @o 0  Ġ%0x p0t p@/p@-P`| @so 4R& R 0p  p &40(/0x0t0p@/=Xp@-PM@P`P 1/0S S 4"4^\0s  D"40 tl l0KE 0D唰pP V@ @$Ѝp@/=0==A-PPMp8y 010/0S S@= 4"4 傀ooP` 0@/@@P0 b\@x ~ zxᡫ|Q0 <0(/x@ЍA/=0=lH=\=`=@-,M@`pPتP@0 < 8D0 bo 00B,Ѝ@/*@-Mt`Pp   @Ѝ@/PQp@-00@P` 50/p p0R3Q/Q Q%  nP  nP 0 S  S R Rmp3p@/=4*  @-@T \ 0^ \ 000 @/R  R 0S0  R R \a@/@-@^:0S @dR0n ^0 N R` @/p@-@Q`0 P/mP:h0\ T/ mP $0%%!/!p@/,+t==p@-@Q`t0r P dd/ mP:$v 0/p@/,+t==0@-@PPM 0|/U` `0X/4 0@P m 00Ѝ0@/t=D0< -@-@Q M0 p$P` |/ 0Pl 0PlkmP:, (0 / Ѝ@Ѝ/,+t== -@-@Q M0 ` p$P / 0Pl 0PlP: ^l 4mP8 40:(/ Ѝ@Ѝ/,+t==p@-@Q`0{ P/mP:0| / P ^:l lP0 ,0: / p@/,+t==p@-@Q`0d P / P: ^l lP0k ,0: / p@/,+t==G-R00?MU$RPQP@T l  +TPX @0T xXXX P\0@6` 0C  0 \>@- @Rttt0t/0AS0 R 0\8 40(/0 0@/=7>==p@-`QP<< 818/@T 1 / R0/ 0S 0/ 0SP  0/   CRLx t0H/ R(@0@$0(@p@/=oqr>s>y=}=0/@/00S/Q/T//0@-@PPM 0 ^ /Ul| x0l/H0S-T 0},0(00LS0 0sЍ0@/=>KSATH?t?O-PPM,p 1R  1/ Z* 1A/Pp!A@G 0(` SB: S@[ 0 S;( R \50 R /V$0$0 Q  0/$00$ R(0(0 P  0/(($0P(@ @$ (0@@T0CQ}@ ЍO/KSAT=>?H???t?-M00jЍ/-M^Ѝ/0@-@MTP 0R  0/ P  0/0Q\pp 0SPPPLPP @R 44 Ѝ0@/MKST=!?"t@&@-@0@-@PM 0 ^ P/0Sl \0gP0AS8DD 0\U Ѝ0@Ѝ0@/>=KSATH?t?@-pPMP 0/@T 0R  0`/P '`0PC\Tp UV 8\ X04/`F Ѝ@/=@KSAT>H?t? A0@-@PPM 0c ^ /x 0S`l0PA\4DD ԪU Ѝ0@ Ѝ0@/>=KSATH?t?p@-`P 0/@T 0R V 0|P/PPW` b0PC\$<< U p@/=V@KSAT>H?^t?@-@P, (0((/@@=0@-@PMP 0R  0/U P x x0p/0QHP M AR ( B@Ѝ0@/KSAT= A\O-t6 M`V \R TT P6PƟ/Q$00&Y []@T] pVW  5ܥ/P^L0L0 0S  5ş/LL RP0P0 Q Xx x5TU/PppPL 0LZ 0%թ R %ͩ PU  5t/ ,o:pPU@ (\$0$0 0S l 4h/$$ R(0(0 Q $d d4 ğ/(00 Z( $  ^  $/ PUP#{pQ\(0P T 3P/P PU(  P00P$W:0P4 #HUs pPW  3Ÿ/^  2|r/0S T 2PŸ/ P ( 2$r/ R "H^D0D0 0S  42/DDpWH0H0  R  1|/HpDpHp0^<d!Pp !ۨ T 00Q\ ʨ ZB  XP@LP(\ Q0SY0P0L0 BP @h 壨 0LPR M ЍO/TMKST=?@KSAT?>FAA@JH?Kt@S??]t?_A=APBhBBBBE-QM`p 0/W 0S  0P/ἠPU , ,P0t 0@P Vx` `PPPPPP P$P(PN,@@ЍE/=CCT!MKSTE-`P Mp 1R  1/W P  1Q/T`!0PPPO @@ @@@@ @(@,@$`0 Cf0@@P0D0H0L0@  Q ܧ( R @ $0S 0 @$0QHPPDHP LR t §T ^00L\ T (04P ЍE/MKST=?HC@@BKSAT@-@P`pM0P0  ^ /h0Shh 0儧 e e0(C\00 @psЍ@/>=KSATH?t?@-@P MP` 41R , $1$/U  1/,`0 㷧PP`) p`V` 8(0p`  Q(P P `$ ( p P0CPDXX  W L, 0 Ѝ@/KSAT=>yH?t?0@-@P MP l1R dd `1`/P4@@!002R(.+Q$0$0 P  0/$   $P(0(0 0S  0/(  0$0(0 R AR 0PP P  Ѝ0@/KSAT=/>;H?AxCCEt?0@-$M0PP%0P0(@ئ@0S$Ѝ0@/- M00 Ѝ/@-pPM<< 828Ÿ/`V 2R  2/,0SC,oP@T@!L(^  1/@0(0 R X!5P ^P@P@LPP@0C\44! H@T @BT@  !0S QPU ^ | 0x@/0S00L P@P$0 0 PЍ@/=CMKST?@CH?t?@TCxtHE$EGIMbRMIT@@lH0 /l0 /h-LM0DSi 808/,, 000Ѝ/ppIxItl@-\0\@ XRTT0T/P (40,/@/\`pI,4I@-X0X@ TRPP0P/ 0R880,/@/\`pI,4I0-0MS0 0;Ѝ/pII@-@M0S0 ) R0/ 0@S0@l T:^Y^P ^  0, 0HH @"Ѝ@/pI!\^,4df!wI@- M0S0  R0/ @T00@0@@S0l ̞T ]^P 7^  /, 0HH 埞 @"Ѝ@/pI3!\5,4d!MIp@-FM P@ `\ @]@P P]P^ /80 ,030 pPe"Fߍp@/ JpI@-KMV@P @ PI/ aa=Cύ 0$E]@4G_;P`pEO2PQ T0 00pP``c4  0]4C!@ PI/ 0 $p]0V0P0S@ T $!B@ P( `V Kߍ@/pI@Bhl0@-! M0S0ttt!p\?d1 6(@T$0$08QQ ( $1$/$ $Q(0(0P0S  0/(  $ 0(  0|@ RP0LS0@`` XP}9P Ѝ0@/pI!\x,JHJ!t#p@-P@0`S 0c/`tQ tt0h/ B TPP0`\D00 p@/ppIdJ|Jthl@-@M^ @`@Pp Y0S#@ ,0  辝P@ p0l@ T($@( @, B\00 3Ѝ@/pI !\x"!0@-,1 AM  u@P?p@P: k@P5f@P0P [P[P [P[P k\  -pp 0  [P  -8< 0Ŝ"@(@@Aߍ0@/`#pIJJx@-@P,4 000/$0 0%$%@/JJ*RIDG-pP  1/[PQ[@@20D m2P0TXS#  ZP$ \ `R @[ azU@  0S0aPPDPUz G/JJ@-@P 8088/1[P[ @/JJ@-@P 8088/P[P[ @/JJ@-@PH D0 < ^Ŕ\(/:[@/JK*RID@-@PL H0 @ ^Ŕ\,/Z05@/JK*RID0@-PPM 0j ^ETp/V[P @0 ZP "0ZZ0Ѝ0@/KJ*RIDp@-`PP 0R ? 0/U@ 0/aZ P@ZWZ T*R/Q/00 @*@YP[> p@/*RIDJKJ@-@pc ;` P0  `0 1`!0 !!  0e!q#"@TPP0@ P0@/@-MP`@p R R R   0@@DTT T T T     \ 1! W  P # 0a 0Ѝ@/ Q 0 a 0R b0bS0c S R 0 R /@- 0MS@`p5 P pPUPpPp U:!0~ !0x 0  00  00P0 Ѝ@/ 0S0 0S SP//- 0\ 0   0S 0.00/p@-@P`Ph0hh  \ ^ T/4\< 80,/ p@8L(LstnEL0@-@PMP 0R  0/U P x 0t/0QH\\ \  @ @R 44 PЍ0@/etnE(L^L_HMatMfM0@-@PM0S00HHH 0P 30,C\(( P*Ѝ0@/U(LtMWM@-@Pp`PM 0 ^ /d0Sll 00 0O\P0008C\0 Ѝ@/(L*LetnE,tM3M@-@PpPM`0  ^ /@0S 0͙  P.U P Q# (B\44 崙Ѝ@/8L(LstnEtMM0@-PPM 0R  0/P 0B0 S \ 0S / @TAP,, rЍ0@/etnE(LLtMME-PPM 2R  2Ÿ/X 2B/Pz"C hWP j  V  .W`VX@p SX{ NXpvX@ *!0@p"@T@n fW0l 0?W0n uWPppXsP @9p@!?C@P0 P! P 8 ?W0Z00`0 W000`004bV@4•`0B` (2BP4B(@  @@WAP Hph 岘  ?W`vZЍE/etnEMLLtMMstnEMO@-@@ P0 X 8 @/Mp@-RM@3P@ `PP,P` ``s+ PP@@@ W.mWVЍp@/N(LN0@-RM`P*0@ 0S <DQ@ W,,W@ 0Ѝ0@/NNp@- P0M`Pd 0 w@T 80@ @ Ѝp@/(L@-PP Mp 1R  1/W P P\ X1LA/`Q 0!! 17@P& `P, P `-V4"R@420B0(4B(…@ 0BS0 d`0CQ @dd 岗>.  0卾 Ѝ@/etnE(LLNtMstnEMG-PPMp, 1R  1/W 1A/X P t 1pa/QD``!e,!P1@P/ 080!`P 2(0 0p ` P `U4•0\@4"0B 0(4B(@ LR h` LR @ll $d 0ЍG/etnE(LaLbNcNetMgstnEMA-pPM`@P (1R   1/V P  0耟/EQ 0/T@U*@ kPUPP00SU @hh h0`&P U<TЍA/etnE(LNXOOO@@?p@- `R@PM0/ lRh0`/ <0k` 0c``Ѝp@/O(LOp@-0@0 MR0`0 4P ll h1h/4^00 0"R $$ (1 /002("R,0/(0@(2 B^dILIpILI8QUP\ 0S /s oT8   0Ѝp@/(LP(PHPp@-@PM 0S 1/P``PLXX! R  ,<1,A/Q Qa0 @T02S  0/   @@@@(,TAP p 崕0SHpp 媕/S\/0傼Ѝp@/(L\PtMP+P1M3P6@-@PM R 0R  0/@Q m0 Rp0p/@ 0C  @AP$@@ STJЍ@/etnE(Ln,QrtMtQyM@-@PM  1/ R 0R  0/ R  @^  0/ 0S0Xxx  7@A\ HH T Ѝ@/(LQstnEAQetnEGLItMOM0@-@PP$M 0 ^ /0S 0Д 0`)$  0 0 (,20 0S0 C\<< 孔$Ѝ0@/(LLJetnELtMlRNM@-`PpMP 0/W 0 @T /0 Ѿ@P0 PP0R4R,R(R厷h 0 PP0 PPP(,R@0Ѝ@/(LD0HMetnEO-PIM@  `7R X P7Pǟ/TP  ((7ǟ/ Q : 0 SPT !P 3 R1#0c\!OPP`P1,"R0š\,Š @,b @00X 0S S,8 RpPPAT 1 #uRPQ  0@nbSQ Q | PT R 8 8 pRp儰p@@ Y @1@#0AS񟗂xSxSS TtT0  @ RPP  4ğ/00  @QP SP P_ hP"P00P \ h4Tğ/0  RP R PQP9 - pWp'WP  0QPR@T T" P0P0`000P A 0 eYu "R0 80 ` 0@V0b Q!a (š@ T: ,bRXR  R 0Q0š5Q  N2R*0^࠱ @@P! R@DQ\V\V\VVV2NA^࠱ 01 2N0^࠱ @@\^ 0 QP0BFpW7X4 8\1`Q 0S  /P#PPpP/.\ U 1 !Pbp\3\0800U0\0S p \ *W 1 !@bXT0OS 00,bIߍO/etnEMLRRO-`PM0@ 3R  3ß/Q 3s/Yh| x3d/0  $S @ @003ß/pQ  #( p } W1 #^  1Q1OR  0OS8\{gPOUP  @OT(PU#Q@$ 0P0 dP2'Q@H&P!ޑ 0m@GxP,( 0Zx 0 # QP 0\ 1! ^09\ 1! a S9# 0 ph Wx O[ 0g00CP!  咑  \ 0: S:#0O xO[00 BPXP u*ЍO/etnE(LLxN!S#tM~N{M0@-(PMPH !P'` U\ UA UK< US U9 U UU2JU, U U. $U6%hPgP'cP: aU06 bU(%dU 0 eU"nP* iU & kUpU  qU &6(  @ ! 0o @ڐ"Ѝ0@/$S4S@-@P, (0(//P@/dS`+@-@P<< 808/0.Sq3@/VdS`+@-@PW @0@@/P00P0@/`+dS-MKOPPDЍ/@-PQMp` 0/V 0/OPO"P P OP 0S`OO@O@T|OЍ@/dSJlSܬ@-@P 4Z000//NP@@/dS`+p@-@PP`x0xx t/Ud `0LP/@N R0N0p@/`+dSvw0@-PP@Ml0 hYd/TT0 DZ@/ *NP qOЍ0@/!dSxS@-@PXM88 404/ p3XЍ@/IdSS0@-PP@M d0ddd/T P0@O@/MP 6OaЍ0@/SdS;S@-@P< 8088/ZNP OH@/.`+dSA-`PMp |1|/W 0S P P1HA/  PR@B =><%Q  A@T:X^ NP%@P\" MP P00| MMpP l,NP@ N@4N&N@@ЍA/dSJSTA-pPMP< 414/U 1 /  0SR@B /H>$Ȁ  @@T:XQ rNP@|`\ 9MP P005Np MЍA/dS!JA-pPP`  1/U 0@/V 0//MPP/M@P NM@gP L0@@MPK> G>``D> `R^ R R sR ( 0(1@\h !~ceR" R% R R&aR cR!nR hR iRpR qR   , * (  6 @" , P@ P ; m0 PS~ , (!((1@( P 0LS08\ X~00Ѝp@/Uk\oiOInUhVvt\yVYDY0`E-QMp G< 0S 0L01 ! 11D@4TP@ <@a`堠9t`pV hh3hß/ 0U* `@PcT V(ßࠁ/N!y<^ e 80`P0 @T 2U2R/ @T$(a,04+ ( x2Z@`lhŸd"d2P0@`8 @Q0A 8 42b/4) ,P @@PG <@=TP`KV UZ VW VU oV(1  0M V 0,0HaV cV 0qV pV eV 0 iV  0 V 0 V (0 hV 60 @L? P# U 0|P;} , tm 00 4*}4 T04   QߍE/!fuBU^D_T`}h`````0@-02 ,MR@P  2Ÿ/ R  Q  1/  0S0!|1< !1 P@ (<p l18/ (0(1  R8 41/ 0 C P80L^ | P$ P P 80$0$ R 8Q o 0@S0\ |,Ѝ0@/U\oiOIUhV`\ t\ V@-QM@P`` \0  P ^ H/ ) P 0; Ѝ@/UUoiOIp@-PPM` 1R  0/V 0@/P ;|(1@@ p"H:P0@p0 ;@  0@\\ |"@ LR @@ |Ѝp@/oiOIUUVhVaV- M0000 n|0P " 0, 0 (0 $DH<48 Ѝ/HtE-PPM@ P4R @@4@ğ/T ( $4d/Z 4s/X 3ß/pW Q  3c/Tl p3dß/`P+0^(XX#{(!   @@3ß/00#{P  0BS0 "i{$} (:p o9@P`:0`S Sq So sSm eS S# S S"aS cSoS hS iS pS qS  ' % # !  ( 6 (!@0(1  @T0!zAP0t! {[{"A0 , ((@\3 4.(((! @0(11,@ LR  9 z j( ( 0 PQ  0 CQP  x` zЍE/oiOIUU 4= X gmOI ] hV YV)(a+3YA-P0M$,P @ `R$p0S0 !z@QZ$pPF , $@WQP p^p 04,!pzp@ R 5 D $PR(P@PD$$$02($@,PD@ 0@P "5@ $@,@$@W 0@S0 @TT 4z,$pP0ЍA/UhV 0a5 Vp@-@`"DH,`<P48 Q0 R00 00 0p@TE-@PMp P$` 1R  0/U 0/ R Q  0/(@p 0l/ 0pP  0$ЍEЍE/oiOIUw Ux gmOI{ ]} TaE-2 MpPS!@Pv `4 P``p,a4a0!1ףP,O 8!1ΣPP4; (@` (!(D`0(1(8`((!<`((1,((! 0(1(1!T` @ (!H`L`P``X\`d`h@l@p`t`x|0娀0``@@``夀@,Q p00!,Q4Q h008!<0 4LS/0" ЍE/U$oiOISVWA-@PM`p 1R 1/PU Q  1/0^!x( t1p/ppp0h!HyP  AR 7@!xp<0$0(0  pP  yLP+ &< 00  ,L0SH(HL 0$ P(0 L  _  BQ PD xЍA/oiOI UUgmOI ] hV ]V G-@P Mp`HP 1R 1/U P  1堑/ PWp@0<1@DaD H!0P  Q,,!4xP^ Q  1 PP PP P00\ @R n x 0 x W\T T0  ЍG/gmOIU ]V@!@`a0@-@PMP p1R hh d1d/P8DD!w( 0 ,1/(1@ 1/  @R 0/U5P BQ| w 7  X 0 sw @" (B0P(1 XH wЍ0@/oiOIU U hV pa Ta a V a p@-P@0MS@`0"]w(@  1/ 0R  @R !Fw/cR P  06P tAe l1@ 0\0X! wp 5P%LQ(!w6P4  P bP- cP(&@ 0 v"ZP 0  (B@0P(1 `, vЍp@/U% hV' a* V7 aA M abW E-鄠M MpP`ᜈ@΍@D P8( 0 ȍ40 0@ǐЍۍE/ bG-@BMPP`p1  /25kP0 ࠁ/P54P5  p0@0 ` 匐P` 5P@5 XHTPH @0`@uPBߍG/Ub @b xbbE-4M $, P@T `R$PSL{   R S2Ÿ/L| 4T( $& $p00$LcP$PLMPP2pZ!1 p$@P Q$p R !u8@Tp $pP P> P< A9 ,b$PW p0S0p !up8Q  <0$S(8 gmOI!O-MpP04 7R 7ǟ/[ Q  6̦//P4B P H^dt    4B0  D @6$,Ɵ/4Bp10Sj*Uh PPU  /1`u14"P@0P4U`4 P05ş倥%0 ݋XP)SN1]P P P `PaPiP 301iO $4e S0$@q"P O4"0!D`V PE_/ e0@$.\ \0TP^ 04`$ X DQ 4 #>0P0i_ h34e 3@0bL#PEqXr4R #>0P0\P i_ E#43e @0#P"q Y40Q"q0i_ %24e 2@0@"Pq4"P,RO 0q0P$( Q!4(P0 f0pu0io 14Re 1@(R0|!P`p42 $@/4@4@4@@4 R $j!p40\4p 1@4B@ @4@4"D@420 ^ @R !p W4 0 y \P4R@@)1 #>/Pwa ߍO/gmOIU ]VXdexd^dpdAdSd^e@e@!@ha@-@MPQ7 P .P /@ P@2@<"<Ÿ0  P P "Ÿ"0Pax.Pt/@ 0!0P@Lc .pPP /@ d1d`!l0 ?.P/PD @ !05  P P  0P*n .P$b/`hP oP.P@ `0`\ d0 @ 48 D(0P@.Ѝ@/heeeef-M-".P */UЍ/-MG.P /JЍ/A-p@`PU. 0.P@ /3X@A/A-@pP`=.0 .PU0 ;.P0.0XPA/-M-P .Ѝ/-M-P .Ѝ/@-@-P.@/@-@PMJ 0/ -pL :o  R0=9 =SA R=)Bx -BR 0TD-Q,P 80$/00Ѝ@/,f8f?B`ffp@-@QP`5 0/ 0S000 P`9l n,0PX T 0.4 A\?( np@/ffffp@-@PP`P0P ZH/<00U[ ,0 ࠁ/P`p@/(gtɚ;g@-@Pcd `0`/ P0@Rd @04ࠁ/Q0s3@/t(gɚ; lserverexithelp?The '%s' command is not yet implemented. fingerrootlsviewThe '%s' command is not implemented. dns_rdata_tostruct origin = %s mail addr = %s serial = %u refresh = %u retry = %u expire = %u minimum = %u rdata_%d = isc_buffer_allocatedns_rdata_totextdetailsection() QUESTIONS: ANSWERS: AUTHORITY RECORDS: ADDITIONAL RECORDS: %s, type = %s, class = %s -> %s printsection()Name: %s Address: %.*s %s printmessage()Server: %s Address: %s ------------** server can't find %s: %s returning with rcode == 0Non-authoritative answer:*** Can't find %s: No answer Authoritative answers can be found from:(q->recvlist).tail == (&q->recvbuf)(q->recvlist).head == (&q->recvbuf)(q->lengthlist).tail == (&q->lengthbuf)(q->lengthlist).head == (&q->lengthbuf)(l->q).tail == (qp)(l->q).head == (qp)(l->my_server_list).tail == (sp)(l->my_server_list).head == (sp)(lookup_list).tail == (lp)(lookup_list).head == (lp)dighost_shutdown()NOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDYXDOMAINYXRRSETNXRRSETNOTAUTHNOTZONERESERVED11RESERVED12RESERVED13RESERVED14RESERVED15BADVERSrtype_0 = internet address = nameserver = md = mf = canonical name = soa = mb = mg = mr = rtype_10 = protocol = name = hinfo = minfo = mail exchanger = text = rp = afsdb = x25 address = isdn address = rt = nsap = nsap_ptr = signature = key = px = gpos = has AAAA address loc = next = rtype_31 = rtype_32 = service = rtype_34 = naptr = kx = cert = v6 address = dname = rtype_40 = optional = @ H P \ h p x              (<DLT\ht| (<DLXdp|dighost.c(search_list).tail == (search)(search_list).head == (search)freeing server %p belonging to %p(lookup->my_server_list).tail == ((dig_server_t *)ptr)(lookup->my_server_list).head == ((dig_server_t *)ptr)freeing buffer %plookup != ((void *)0)try_clear_lookup(%p)query to %s still pendingquery != ((void *)0)clear_query(%p)(lookup->q).tail == (query)(lookup->q).head == (query)(query->recvlist).tail == (&query->recvbuf)(query->recvlist).head == (&query->recvbuf)(query->lengthlist).tail == (&query->lengthbuf)(query->lengthlist).head == (&query->lengthbuf)query->recvspace != ((void *)0)sockcount=%dcheck_if_done()emptyfulllist %ssockcount == 0recvcount == 0shutting downcancel_lookup()flush_server_list()(server_list).tail == (ps)(server_list).head == (ps)%s: couldn't get address for '%s': %scount == 1memory allocation failure in %s:%dmake_empty_lookup()!free_nowservname != ((void *)0)make_server(%s)clone_server_list()clone_lookup()looknew != ((void *)0)requeue_lookup()too many lookupsbefore insertion, init@%p -> %p, new@%p -> %pafter insertion, init -> %p, new = %p, new -> %pdestroy_libs()freeing taskfreeing taskmgrlock_lookup %s:%disc_mutex_locksuccesssendcount == 0((lookup_list).head) == ((void *)0)current_lookup == ((void *)0)freeing commctxfreeing socketmgrfreeing timermgrfreeing key %pdestroy DST libdetach from entropyunlock_lookup %s:%disc_mutex_unlock(*((&lookup_lock)) == 0 ? (*((&lookup_lock)) = -1, 0) : 34) == 0cancel_all()cancelling query %p, belonging to %p(lookup_list).tail == (l)(lookup_list).head == (l)bringup_timer()have local timeout of %disc_timer_createsend_udp(%p)working on lookup %p, query %pisc_socket_createisc_socket_bindrecving with lookup=%p, query=%p, sock=%pisc_socket_recvvrecvcount=%dsending a requestisc_time_now((&query->time_sent)) == 0query->sock != ((void *)0)isc_socket_sendtovevent->ev_type == (((2) << 16) + 2)send_done()sendcount=%dsendcount >= 0(sevent->bufferlist).tail == (b)(sevent->bufferlist).head == (b)sending next, since searchingfollowing up %sfound NS set;; BAD (HORIZONTAL) REFERRAL;; BAD REFERRALfound NS %d %sadding server %s(lookup->my_server_list).tail == (srv)(lookup->my_server_list).head == (srv)setup_lookup(%p)dns_message_createresetting lookup counter.cloning server listdns_message_gettempnametrying origin %s'%s' is not in legal name syntax (%s)using root origin'%s' is not a legal name (%s)dns_name_isabsolute(lookup->name)recursive queryAA queryAD queryCD queryadd_question()dns_message_gettemprdataset()insert_soa()dns_message_gettemprdataisc_rdata_fromstructdns_message_gettemprdatalistdns_message_gettemprdatasetinitializing keysdns_message_settsigkeydns_compress_initstarting to render the messagedns_message_renderbeginadd_opt()setting udp size of %ddns_message_setoptdns_message_rendersectiondns_message_renderenddone renderingcreate query %p linked to lookup %pstart_lookup()(lookup_list).tail == (current_lookup)(lookup_list).head == (current_lookup)check_next_lookup(%p)still have a workerlaunch_next_query()ignoring launch_next_query because !pendingsockcount >= 0sending a request in launch_next_queryisc_socket_sendvevent->ev_type == (((2) << 16) + 1)tcp_length_done()recvcount >= 0b == &query->lengthbuf;; communications error to %s: %s (((query->recvlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)recving with lookup=%p, query=%presubmitted recv request with length %d, recvcount=%dsend_tcp_connect(%p);; Skipping server %s, incompatible address family ;; No acceptable nameserversquery->sock == ((void *)0)isc_socket_connectdo_lookup()recv_done()lookup=%p, query=%pb == &query->recvbuf(sevent->bufferlist).tail == (&query->recvbuf)(sevent->bufferlist).head == (&query->recvbuf)no longer pending. Got %sin recv cancel handler;; communications error: %s ;; reply from unexpected source: %s, expected %s ERRORWARNING;; %s: ID mismatch: expected ID %u, got %u ;; ERROR: short (< header size) message;; Warning: ID mismatch: expected ID %u, got %u ;; Warning: short (< header size) message received;; Warning: query response not setgetting initial querysigdns_message_getquerytsigdns_message_setquerytsigbefore parse starts;; Warning: Message parser reports malformed message packet.;; Got bad packet: %s %d bytes %02x ;; Truncated, retrying in TCP mode.sending query %p SERVFAIL replyrecursion not available;; Got %s from %s, trying next server ;; Couldn't verify signature: %s freeing querysig buffer %pafter parseisc_timer_resetnext_origin()in TRACE codein NSSEARCH codestill pending.check_for_more_data(); Transfer failed.; Transfer failed. Didn't start with SOA answer.got the second rr as nonsoagot an SOAthis is the first %ddoing axfr, got second SOAdoing ixfr, got empty zonethis is the second %ddone, since axfrgot a match for ixfrdone with ixfrmeaningless soa %devent->ev_type == (((2) << 16) + 4)connect_done()query->waiting_connectin cancel handlerunsuccessful connection: %s;; Connection to %s(%s) for %s failed: %s. event->ev_type == (((1) << 16) + 2)connect_timeout()trying next server...resending UDP request to first servermaking new TCP request, %d tries left;; connection timed out; no servers could be reachedsetup_libs()can't find either v4 or v6 networkingisc_mem_createisc_taskmgr_createisc_task_createisc_timermgr_createisc_socketmgr_createisc_entropy_createdst_lib_initisc_mempool_createCOMMPOOLisc_mutex_initsetup_system()lwres_context_create failed/etc/resolv.confparse of %s failedcreate_search_list()ndots is %d.127.0.0.1add_nameserver failed::1copy_server_list()setup_file_key()Couldn't read key from %s: %s ;; Couldn't create key %s: bad algorithm ;; Couldn't create key %s: %s setup_text_key()dns_name_init.in-addr.arpa.len != 0Ucontext.cmem != ((void *)0)contextp != ((void *)0) && *contextp != ((void *)0)contextp != ((void *)0) && *contextp == ((void *)0)malloc_function == ((void *)0)free_function == ((void *)0)lwres_context_allocmemlwres_context_freememlwres_context_initseriallwres_context_nextseriallwres_context_destroylwres_context_createlwconfig.cbuffer != ((void *)0)size > 0Ustr != ((void *)0)strlen(str) > 0Ufilename != ((void *)0)strlen(filename) > 0Unameserverlwserversortlistoptionsno_tld_queryndots:confdata->nsnext <= 3nameserver %s lwserver %s domain %s confdata->searchnxt <= 8confdata->sortlistnxt <= 10options debug options ndots:%d options no_tld_query lwres_conf_getlwres_conf_printlwres_conf_parsegetwordlwres_strduplwres_conf_clearlwres_resetaddrlwres_conf_initcp != ((void *)0)lwinetaton.clwres_net_aton01234567890123456789ABCDEF0123456789abcdef%x%u.%u.%u.%ubyaddr.cbyaddrp != ((void *)0)(((byaddr) != ((void *)0)) && (((const isc__magic_t *)(byaddr))->magic == ((('B') << 24 | ('y') << 16 | ('A') << 8 | ('d')))))byaddr->event == ((void *)0)byaddr->task == ((void *)0)(*((&byaddr->lock)) == 0 ? (*((&byaddr->lock)) = -1, 0) : 34) == 0((*((&byaddr->lock)))++ == 0 ? 0 : 34) == 0(--(*((&byaddr->lock))) == 0 ? 0 : 34) == 0event->ev_type == (((4) << 16) + 30)byaddr->task == taskevent->ev_type == (((4) << 16) + 16)(bevent->names).tail == (name)(bevent->names).head == (name)address != ((void *)0)%u.%u.%u.%u.in-addr.arpa.ip6.int.ip6.arpa.0123456789abcdefcompress.ccctx != ((void *)0)mctx != ((void *)0)(((cctx) != ((void *)0)) && (((const isc__magic_t *)(cctx))->magic == ((('C') << 24 | ('C') << 16 | ('T') << 8 | ('X')))))dctx != ((void *)0)edns >= -1 && edns <= 255(((dctx) != ((void *)0)) && (((const isc__magic_t *)(dctx))->magic == ((('D') << 24 | ('C') << 16 | ('T') << 8 | ('X')))))(((name)->attributes & 0x0001) != 0 ? isc_boolean_true : isc_boolean_false) == isc_boolean_trueoffset != ((void *)0)labels > 0(((name)->attributes & 0x0001) != 0 ? isc_boolean_true : isc_boolean_false)lookup.clookupp != ((void *)0)((((lookup)) != ((void *)0)) && (((const isc__magic_t *)((lookup)))->magic == ((('l') << 24 | ('o') << 16 | ('o') << 8 | ('k')))))lookup->event == ((void *)0)lookup->task == ((void *)0)lookup->view == ((void *)0)(*((&lookup->lock)) == 0 ? (*((&lookup->lock)) = -1, 0) : 34) == 0((*((&lookup->lock)))++ == 0 ? 0 : 34) == 0lookup->view != ((void *)0)(--(*((&lookup->lock))) == 0 ? 0 : 34) == 0!dns_rdataset_isassociated(&lookup->rdataset)!dns_rdataset_isassociated (&lookup->sigrdataset)lookup->event->db != ((void *)0)lookup->fetch == ((void *)0)event->rdataset == &lookup->rdatasetevent->sigrdataset == &lookup->sigrdatasetnamereln == dns_namereln_subdomainevent->ev_type == (((4) << 16) + 1)lookup->task == taskfevent->fetch == lookup->fetchmessage.cdynbuf != ((void *)0)*rdataset == ((void *)0)(((msg) != ((void *)0)) && (((const isc__magic_t *)(msg))->magic == ((('M') << 24 | ('S') << 16 | ('G') << 8 | ('@')))))space <= msg->reserved(((section) > (-1)) && ((section) < 4))msg->cursors[section] != ((void *)0)name != ((void *)0) && *name == ((void *)0)msg != ((void *)0)msg->from_to_wire == 2(((fromsection) > (-1)) && ((fromsection) < 4))(((tosection) > (-1)) && ((tosection) < 4))(msg->sections[fromsection]).tail == (name)(msg->sections[fromsection]).head == (name)(msg->sections[section]).tail == (name)(msg->sections[section]).head == (name)item != ((void *)0) && *item != ((void *)0)owner == ((void *)0) || *owner == ((void *)0)(((*buffer) != ((void *)0)) && (((const isc__magic_t *)(*buffer))->magic == (0x42756621U)))opcode < 16target != ((void *)0)(((section) >= (-1)) && ((section) < 3));; OPT PSEUDOSECTION: ; EDNS: version: , flags: do; MBZ: %.4x , udp: ; udp: ; NSID; OPT= (;; TSIG PSEUDOSECTION: ;; SIG0 PSEUDOSECTION: (((section) >= (-1)) && ((section) < 4));; SECTION: ;;; ->>HEADER<<- opcode: , status: %4u, id: %6u ;; flags: qr aa tc rd ra ad cd ; QUESTION: ; ZONE: %1u, ANSWER: , PREREQ: , AUTHORITY: , UPDATE: , ADDITIONAL: msg->saved.base != ((void *)0)result == 0signer != ((void *)0)msg->from_to_wire == 1result != 0querytsig != ((void *)0) && *querytsig == ((void *)0)!dns_rdataset_isassociated(*item)dns_rdataset_isassociated(msg->opt)dns_rdataset_isassociated(msg->tsig)msg->namepool != ((void *)0)msg->querytsig == ((void *)0)dns_rdataset_isassociated(msg->sig0)(msg->sections[i]).tail == (name)(msg->sections[i]).head == (name)(name->list).tail == (rds)(name->list).head == (rds)dns_rdataset_isassociated(rds)source != ((void *)0)item != ((void *)0) && *item == ((void *)0)(msg->freerdatalist).tail == (rdatalist)(msg->freerdatalist).head == (rdatalist)(msg->freerdata).tail == (rdata)(msg->freerdata).head == (rdata)*name == ((void *)0)msg->state == (-1)msg->sig0key == ((void *)0) && msg->tsigkey == ((void *)0)msg->tsigkey == ((void *)0) && msg->sig0key == ((void *)0)opt->type == ((dns_rdatatype_t)dns_rdatatype_opt)(msg->flags & 0x8000U) == 0msg->buffer == ((void *)0)r.length >= 12msg->counts[0] < 65536 && msg->counts[1] < 65536 && msg->counts[2] < 65536 && msg->counts[3] < 65536msg->buffer != ((void *)0)(((sectionid) > (-1)) && ((sectionid) < 4))st.used < 65536rn.length > r.lengthtrysize != 0dns_rdatalist_tordataset(rdatalist, rdataset) == 0free_name == isc_boolean_falsefree_rdataset == isc_boolean_false!dns_rdataset_isassociated(rdataset)message has %u byte(s) of trailing garbage(msg->scratchpad).tail == (dynbuf)(msg->scratchpad).head == (dynbuf)(msg->rdatas).tail == (msgblock)(msg->rdatas).head == (msgblock)(msg->rdatalists).tail == (msgblock)(msg->rdatalists).head == (msgblock)(msg->offsets).tail == (msgblock)(msg->offsets).head == (msgblock)(msg->cleanup).tail == (dynbuf)(msg->cleanup).head == (dynbuf)isc_mempool_getallocated(msg->namepool) == 0isc_mempool_getallocated(msg->rdspool) == 0msgp != ((void *)0)(((*msgp) != ((void *)0)) && (((const isc__magic_t *)(*msgp))->magic == ((('M') << 24 | ('S') << 16 | ('G') << 8 | ('@')))))intent == 1 || intent == 2*msgp == ((void *)0)msg:namesmsg:rdataset(m->scratchpad).tail == (dynbuf)(m->scratchpad).head == (dynbuf)QUERYIQUERYSTATUSRESERVED3NOTIFYUPDATERESERVED6RESERVED7RESERVED8RESERVED9RESERVED10QUESTIONANSWERAUTHORITYADDITIONALZONEPREREQUISITECCCCCCCCCCC     @ H P \ h p x           CD DD$D,DCDname.c(((name) != ((void *)0)) && (((const isc__magic_t *)(name))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(buffer != ((void *)0) && name->buffer == ((void *)0)) || (buffer == ((void *)0))name->labels > 0name->attributes & 0x0001n <= 63count <= 63(((name1) != ((void *)0)) && (((const isc__magic_t *)(name1))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(((name2) != ((void *)0)) && (((const isc__magic_t *)(name2))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(name1->attributes & 0x0001) == (name2->attributes & 0x0001)name1->labels > 0(name1->attributes & 0x0001) != 0name2->labels > 0(name2->attributes & 0x0001) != 0count1 <= 63 && count2 <= 63l1 == l2name->labels <= 128nlabels < 128offset <= lengthset_name == namenlabels == name->labelsoffset == name->length(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))first <= source->labelsfirst + n <= source->labels((target->attributes & (0x0002|0x0004)) == 0)n < name->labelslabel != ((void *)0)orderp != ((void *)0)nlabelsp != ((void *)0)(((wname) != ((void *)0)) && (((const isc__magic_t *)(wname))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))dns_name_iswildcard(wname)suffixlabels > 0suffixlabels < name->labelsprefix != ((void *)0) || suffix != ((void *)0)prefix == ((void *)0) || ((((prefix) != ((void *)0)) && (((const isc__magic_t *)(prefix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n'))))) && prefix->buffer != ((void *)0) && ((prefix->attributes & (0x0002|0x0004)) == 0))suffix == ((void *)0) || ((((suffix) != ((void *)0)) && (((const isc__magic_t *)(suffix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n'))))) && suffix->buffer != ((void *)0) && ((suffix->attributes & (0x0002|0x0004)) == 0))((name->attributes & (0x0002|0x0004)) == 0)(((dest) != ((void *)0)) && (((const isc__magic_t *)(dest))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))target != ((void *)0) || dest->buffer != ((void *)0)((dest->attributes & (0x0002|0x0004)) == 0)(name->attributes & 0x0004) != 0source->length > 0target->offsets == ((void *)0)prefix == ((void *)0) || (((prefix) != ((void *)0)) && (((const isc__magic_t *)(prefix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))suffix == ((void *)0) || (((suffix) != ((void *)0)) && (((const isc__magic_t *)(suffix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))name == ((void *)0) || (((name) != ((void *)0)) && (((const isc__magic_t *)(name))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(target != ((void *)0) && (((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == (0x42756621U)))) || (target == ((void *)0) && name != ((void *)0) && (((name->buffer) != ((void *)0)) && (((const isc__magic_t *)(name->buffer))->magic == (0x42756621U))))!copy_suffixname->buffer != ((void *)0)(((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == (0x42756621U)))(name->attributes & 0x0002) == 0(target != ((void *)0) && (((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == (0x42756621U)))) || (target == ((void *)0) && (((name->buffer) != ((void *)0)) && (((const isc__magic_t *)(name->buffer))->magic == (0x42756621U))))nlen >= countUnexpected label type %02xdigest != ((void *)0)Unknown state %d(name->attributes & 0x0001) != 0%%%02X(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == (0x42756621U)))labels <= 127Unexpected state %dtlen == 0count != 0n2 <= 63  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  ANYCHHSINNONERESERVED0CLASS%uanychaoshshesiodnonereserved0rcode.cbuffer[source->length] == '\0'NOCONFNOAUTHNOKEYFLAG2EXTENDFLAG4FLAG5USERHOSTNTYP3FLAG8FLAG9FLAG10FLAG11SIG0SIG1SIG2SIG3SIG4SIG5SIG6SIG7SIG8SIG9SIG10SIG11SIG12SIG13SIG14SIG15KSKTLSEMAILDNSSECIPSECALLRSAMD5RSADHDSAECCRSASHA1INDIRECTPRIVATEDNSPRIVATEOIDPKIXSPKIPGPURIOIDBADSIGBADKEYBADTIMEBADMODEBADNAMEBADALGBADTRUNC%d %d %d.%03d %s %d %d %d.%03d %s %s%ld.%02ldm %s %s %s./rdata/in_1/apl_42.capl != ((void *)0)apl->common.rdtype == 42apl->common.rdclass == 1apl->apl != ((void *)0) || apl->apl_len == 0apl->apl_len > 3Ulength <= apl->apl_lenapl->offset < apl->apl_lenapl->offset <= apl->apl_len - 4Ulength + apl->offset <= apl->apl_lenapl->offset <= apl->apl_lenrdata.crdata != ((void *)0)!((void *)((rdata)->link.prev) != (void *)(-1))(((rdata)->flags & ~0x0001) == 0)src != ((void *)0)(((src)->flags & ~0x0001) == 0)(((target)->flags & ~0x0001) == 0)region->length >= 4region->length >= 2region->length >= 1./rdata/generic/sig_24.crdata->type == 24./rdata/generic/hinfo_13.chinfo->common.rdtype == typehinfo->common.rdclass == rdclass./rdata/generic/null_10.cnull->common.rdtype == typenull->common.rdclass == rdclassnull->data != ((void *)0) || null->length == 0MDMFCNAMEMBMGMRNULLWKSPTRHINFOMINFOMXTXTRPAFSDBX25ISDNRTNSAPNSAP-PTRSIGKEYPXGPOSAAAALOCNXTEIDNIMLOCSRVATMANAPTRKXCERTA6DNAMEOPTAPLDSSSHFPIPSECKEYRRSIGNSECDNSKEYDHCIDSPFUINFOUIDGIDUNSPECTKEYTSIGIXFRMAILBMAILATYPE%un + 1 <= source->length_r->length >= _lmdmfcnamemxmbmgmrminfonullkxwksptrnaptrhinfotxtrpafsdbx25isdnnsapuidnsap-ptrsigdlvpxgposaaaaatmalocnxteidnimlocsrvcerta6dnameoptaplsshfpipseckeyrrsigdnskeydhcidspfuinfogidunspecmailbmailaadd != ((void *)0)./rdata/generic/mx_15.c./rdata/generic/afsdb_18.c./rdata/generic/rt_21.c./rdata/in_1/srv_33.c./rdata/in_1/naptr_35.c./rdata/in_1/kx_36.c./rdata/generic/ptr_12.crdata->type == 12./rdata/generic/soa_6.c./rdata/generic/minfo_14.c./rdata/in_1/a6_38.c./rdata/any_255/tsig_250.crdata->rdclass == 250rdata->type == 35rdata->rdclass == 1rdata->type == 33./rdata/generic/nxt_30.crdata->type == 30./rdata/in_1/px_26.crdata->type == 26rdata->type == 21rdata->type == 18./rdata/generic/rp_17.crdata->type == 17rdata->type == 15rdata->type == 14./rdata/generic/mr_9.crdata->type == 9./rdata/generic/mg_8.crdata->type == 8./rdata/generic/mb_7.crdata->type == 7rdata->type == 6./rdata/generic/cname_5.crdata->type == 5./rdata/generic/mf_4.crdata->type == 4./rdata/generic/md_3.crdata->type == 3./rdata/generic/ns_2.crdata->type == 2./rdata/ch_3/a_1.crdata->type == 1rdata->rdclass == ((dns_rdataclass_t)dns_rdataclass_ch)./rdata/generic/sshfp_44.csshfp != ((void *)0)sshfp->common.rdtype == 44./rdata/generic/ds_43.cds != ((void *)0)ds->common.rdtype == 43./rdata/generic/opt_41.copt->common.rdtype == 41./rdata/generic/cert_37.ccert != ((void *)0)cert->common.rdtype == 37naptr->common.rdclass == 1naptr->common.rdtype == 35nxt->common.rdtype == 30./rdata/generic/gpos_27.cgpos->common.rdtype == 27./rdata/generic/key_25.ckey->common.rdtype == 25sig->common.rdtype == 24./rdata/in_1/nsap_22.cnsap->common.rdclass == 1nsap->common.rdtype == 22./rdata/generic/isdn_20.c./rdata/generic/x25_19.cx25->common.rdtype == 19./rdata/generic/txt_16.ctxt->common.rdtype == 16./rdata/in_1/wks_11.cwks->common.rdtype == 11wks->common.rdclass == 1null->common.rdtype == 10a6->common.rdclass == 1a6->common.rdtype == 38./rdata/in_1/a_1.ca->common.rdtype == 1a->common.rdclass == 1md->common.rdtype == 3mf->common.rdtype == 4soa->common.rdtype == 6mg->common.rdtype == 8mr->common.rdtype == 9ptr->common.rdtype == 12minfo->common.rdtype == 14mx->common.rdtype == 15rp->common.rdtype == 17afsdb->common.rdtype == 18rt->common.rdtype == 21./rdata/in_1/nsap-ptr_23.cnsap_ptr->common.rdclass == 1nsap_ptr->common.rdtype == 23px->common.rdclass == 1px->common.rdtype == 26./rdata/in_1/aaaa_28.caaaa->common.rdclass == 1aaaa->common.rdtype == 28./rdata/generic/loc_29.cloc->common.rdtype == 29srv->common.rdclass == 1srv->common.rdtype == 33kx->common.rdclass == 1kx->common.rdtype == 36./rdata/generic/dname_39.cdname->common.rdtype == 39./rdata/generic/ipseckey_45.cipseckey->common.rdtype == 45./rdata/generic/rrsig_46.csig->common.rdtype == 46./rdata/generic/nsec_47.cnsec->common.rdtype == 47./rdata/generic/dnskey_48.cdnskey->common.rdtype == 48./rdata/in_1/dhcid_49.cdhcid->common.rdtype == 49dhcid->common.rdclass == 1./rdata/generic/spf_99.ctxt->common.rdtype == 99./rdata/generic/unspec_103.cunspec->common.rdtype == 103./rdata/generic/tkey_249.ctsig->common.rdclass == 255tsig->common.rdtype == 250./rdata/generic/dlv_32769.cdlv->common.rdtype == 32769rdata->type == 23rdata->length != 0rdata->type == 32769rdata->type == 250rdata->rdclass == 255sr.length >= 6sr.length >= tsig->siglensr.length == tsig->otherlenrdata->type == 249rdata->type == 103rdata->type == 99rdata->type == 49rdata->type == 48rdata->type == 47rdata->type == 46rdata->type == 45rdata->length >= 3rdata->type == 44rdata->type == 43rdata->type == 42rdata->type == 41rdata->type == 37naptr->flags_len <= r.lengthnaptr->service_len <= r.lengthnaptr->regexp_len <= r.lengthrdata->type == 27rdata->type == 25rdata->type == 22rdata->type == 20rdata->type == 19rdata->type == 16rdata->type == 13rdata->type == 11rdata->type == 10rdata->type == 38r.length >= octetsrdata->length == 4./rdata/hs_4/a_1.crdata->length == 16r.length == 16loc->common.rdtype == typeloc->common.rdclass == rdclassa->common.rdtype == typea->common.rdclass == rdclasstype == 47nsec->common.rdtype == typensec->common.rdclass == rdclassnsec->typebits != ((void *)0) || nsec->len == 0i + 2 <= nsec->lenfirst || window > lastwindowlen > 0 && len <= 32i + len <= nsec->lennsec->typebits[i + len - 1] != 0!firsttype == 45ipseckey->common.rdtype == typeipseckey->common.rdclass == rdclassdname->common.rdtype == typedname->common.rdclass == rdclassa6->common.rdtype == typea6->common.rdclass == rdclassnxt->common.rdtype == typenxt->common.rdclass == rdclassnxt->typebits != ((void *)0) || nxt->len == 0nxt->len <= 16nxt->typebits[nxt->len - 1] != 0nsap_ptr->common.rdtype == typensap_ptr->common.rdclass == rdclassrp->common.rdtype == typerp->common.rdclass == rdclassminfo->common.rdtype == typeminfo->common.rdclass == rdclassptr->common.rdtype == typeptr->common.rdclass == rdclassmr->common.rdtype == typemr->common.rdclass == rdclassmg->common.rdtype == typemg->common.rdclass == rdclassmb->common.rdtype == typemb->common.rdclass == rdclasssoa->common.rdtype == typesoa->common.rdclass == rdclasscname->common.rdtype == typecname->common.rdclass == rdclassmf->common.rdtype == typemf->common.rdclass == rdclassmd->common.rdtype == typemd->common.rdclass == rdclassns->common.rdtype == typens->common.rdclass == rdclasstype == 32769dlv->common.rdtype == typedlv->common.rdclass == rdclassdlv->length == 20Udlv->length == 32Utsig->common.rdclass == rdclasstsig->common.rdtype == typetkey->common.rdtype == typetkey->common.rdclass == rdclasstype == 48dnskey->common.rdtype == typednskey->common.rdclass == rdclasstype == 46sig->common.rdtype == typesig->common.rdclass == rdclasssig->signature != ((void *)0) || sig->siglen == 0type == 43ds->common.rdtype == typeds->common.rdclass == rdclassds->length == 20Uds->length == 32Ucert->common.rdtype == typecert->common.rdclass == rdclasskx->common.rdtype == typekx->common.rdclass == rdclassnaptr->common.rdtype == typenaptr->common.rdclass == rdclassnaptr->flags != ((void *)0) || naptr->flags_len == 0naptr->service != ((void *)0) || naptr->service_len == 0naptr->regexp != ((void *)0) || naptr->regexp_len == 0srv->common.rdtype == typesrv->common.rdclass == rdclasspx->common.rdtype == typepx->common.rdclass == rdclasskey->common.rdtype == typekey->common.rdclass == rdclassrt->common.rdtype == typert->common.rdclass == rdclassafsdb->common.rdclass == rdclassafsdb->common.rdtype == typemx->common.rdtype == typemx->common.rdclass == rdclasswks->common.rdtype == typewks->common.rdclass == rdclasswks->map != ((void *)0) || wks->map_len == 0x25->common.rdtype == typex25->common.rdclass == rdclassx25->x25 != ((void *)0) && x25->x25_len != 0type == 42apl->common.rdtype == typeapl->common.rdclass == rdclasstxt->common.rdtype == typetxt->common.rdclass == rdclasstxt->txt != ((void *)0) && txt->txt_len != 0isdn->common.rdtype == typeisdn->common.rdclass == rdclassnsap->common.rdtype == typensap->common.rdclass == rdclassnsap->nsap != ((void *)0) || nsap->nsap_len == 0gpos->common.rdtype == typegpos->common.rdclass == rdclassaaaa->common.rdtype == typeaaaa->common.rdclass == rdclassopt->common.rdtype == typeopt->common.rdclass == rdclassopt->options != ((void *)0) || opt->length == 0sshfp->common.rdtype == typesshfp->common.rdclass == rdclassdhcid->common.rdtype == typedhcid->common.rdclass == rdclassdhcid->length != 0unspec->common.rdtype == typeunspec->common.rdclass == rdclassunspec->data != ((void *)0) || unspec->datalen == 0%u )rdata->type == 29%lum0.%02lumW-0x%02xrdata->length >= 5i + 2 <= sr.lengthi + len <= sr.lengthrdata->type == 39prefixlen <= 128rdata->type == 36%onumlen > 0 && numlen < sizeof("2147483647") ; ( ; %u %u %un < sizeof(buf)%u %ur.length >= length ; key id = n <= sr.length ) %lu tctx->origin == ((void *)0) || dns_name_isabsolute(tctx->origin) == isc_boolean_truerdata->length == 0sr.length >= 4!%s%s%u:n < (int)sizeof(txt)len <= 4prefix <= 32len <= 16prefix <= 128/%ux %d %x %x %x\# sr.length < 65536 ( UNKNOWN%s:%lu: "%s" is not a decimal dotted quad%s: %s:%lu: near eol: %sdns_rdata_fromtext%s: %s:%lu: near eof: %s%s: %s:%lu: near %lu: %s%s: %s:%lu: near '%s': %s%s: %s:%lu: %sdns_rdata_fromtext: %s:%lu: %s%s:%u: warning: %s: %s%s:%u: warning: '%s': %stcpudptype == 99%s: %s:%u: '%s' extra precision digits ignoredtype == 103%s:%lu: file does not end with newlinetarget->used < 65536activelength < 65536origin == ((void *)0) || dns_name_isabsolute(origin) == isc_boolean_truecallbacks->warn != ((void *)0)callbacks->error != ((void *)0)\#rdata1->type == rdata2->typerdata1->rdclass == rdata2->rdclassrdata1->type == 41rdata1->type == 37rdata1->length != 0rdata2->length != 0rdata1->type == 29rdata1->type == 28rdata1->rdclass == 1rdata1->length == 16rdata2->length == 16rdata1->type == 27rdata1->type == 25rdata1->type == 22rdata1->type == 20rdata1->type == 19rdata1->type == 16rdata1->type == 13rdata1->type == 11rdata1->type == 10rdata1->type == 1rdata1->length == 4rdata2->length == 4rdata1->type == 250rdata1->rdclass == 255rdata1->type == 249rdata1->type == 39rdata1->type == 30rdata1->type == 24r1.length > 18r2.length > 18rdata1->type == 23rdata1->type == 17rdata1->type == 14rdata1->type == 12rdata1->type == 9rdata1->type == 8rdata1->type == 7rdata1->type == 6rdata1->type == 5rdata1->type == 4rdata1->type == 3rdata1->type == 2rdata1->type == 38rdata1->type == 36rdata1->type == 35rdata1->type == 33rdata1->type == 26rdata1->type == 21rdata1->type == 18rdata1->type == 15rdata1->rdclass == 4rdata1->rdclass == ((dns_rdataclass_t)dns_rdataclass_ch)rdata1 != ((void *)0)rdata2 != ((void *)0)rdata1->data != ((void *)0)rdata2->data != ((void *)0)(((rdata1)->flags & ~0x0001) == 0)(((rdata2)->flags & ~0x0001) == 0)rdata1->length >= 3rdata2->length >= 3serialrefreshretryexpireminimumnSND<JnSNDP ZnSND` i (08 d'@B!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu01234567890123456789abcdef d'@Brdatalist.crdatalist != ((void *)0) && rdataset != ((void *)0)(rdataset->attributes & 0x00004000) != 0list_rdata != ((void *)0)rdatalist != ((void *)0)(((rdataset) != ((void *)0)) && (((const isc__magic_t *)(rdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))! dns_rdataset_isassociated(rdataset)rdataset.crdataset->methods == ((void *)0)rdataset->methods != ((void *)0)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))source->methods != ((void *)0)(((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))target->methods == ((void *)0)zonep == ((void *)0) || *zonep == ((void *)0)dbp != ((void *)0) && *dbp == ((void *)0)versionp != ((void *)0) && *versionp == ((void *)0)nodep != ((void *)0) && *nodep == ((void *)0)fname != ((void *)0)(rdataset->attributes & 0x00000001) == 0countp != ((void *)0)(order == ((void *)0)) == (order_arg == ((void *)0))cctx != ((void *)0) && cctx->mctx != ((void *)0)result == 29i < counti == countorder != ((void *)0)(target->used >= rdlen.used + 2) && (target->used - rdlen.used - 2 < 65536)rrbuffer.used < 65536savedbuffer.used < 65536state == ((void *)0)%s %s%s%sresolving '%s/%s/%s': %sresolver.c(((res) != ((void *)0)) && (((const isc__magic_t *)(res))->magic == ((('R') << 24 | ('e') << 16 | ('s') << 8 | ('!')))))!res->frozen(((resolver) != ((void *)0)) && (((const isc__magic_t *)(resolver))->magic == ((('R') << 24 | ('e') << 16 | ('s') << 8 | ('!')))))ndisps > 0(res->options & 0x04) != 0 || (res->options & 0x08) != 0res->dispatchv4 != ((void *)0)result == 0 && isc_sockaddr_getport(&addr4) == 0res->dispatchv6 != ((void *)0)result == 0 && isc_sockaddr_getport(&addr6) == 0((*((&resolver->lock)))++ == 0 ? 0 : 34) == 0(--(*((&resolver->lock))) == 0 ? 0 : 34) == 0((*((&resolver->nlock)))++ == 0 ? 0 : 34) == 0(--(*((&resolver->nlock))) == 0 ? 0 : 34) == 0((*((&res->lock)))++ == 0 ? 0 : 34) == 0(--(*((&res->lock))) == 0 ? 0 : 34) == 0((*((&res->poollock)))++ == 0 ? 0 : 34) == 0(--(*((&res->poollock))) == 0 ? 0 : 34) == 0could not update an IPv4 random query port: %scould not update an IPv6 random query port: %s(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('R') << 24 | ('e') << 16 | ('s') << 8 | ('!')))))targetp != ((void *)0) && *targetp == ((void *)0)res %p: %sattach((*((&source->lock)))++ == 0 ? 0 : 34) == 0!source->exitingsource->references > 0source->references != 0(--(*((&source->lock))) == 0 ? 0 : 34) == 0!resolver->frozen(alt == ((void *)0)) ^ (name == ((void *)0))(((fctx) != ((void *)0)) && (((const isc__magic_t *)(fctx))->magic == ((('F') << 24 | ('!') << 16 | ('!') << 8 | ('!')))))fctx->state == fetchstate_done || fctx->state == fetchstate_init(((fctx->events).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->queries).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->finds).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->altfinds).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)fctx->pending == 0fctx->references == 0(((fctx->validators).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)fctx %p(%s'): %s(res->buckets[bucketnum].fctxs).tail == (fctx)(res->buckets[bucketnum].fctxs).head == (fctx)(fctx->bad).tail == (sa)(fctx->bad).head == (sa)(fctx->edns).tail == (sa)(fctx->edns).head == (sa)(fctx->edns512).tail == (sa)(fctx->edns512).head == (sa)((*((&res->nlock)))++ == 0 ? 0 : 34) == 0(--(*((&res->nlock))) == 0 ? 0 : 34) == 0shutdown(((fetch) != ((void *)0)) && (((const isc__magic_t *)(fetch))->magic == ((('F') << 24 | ('t') << 16 | ('c') << 8 | ('h')))))fetch %p (fctx %p(%s)): %scancelfetch((*((&res->buckets[fctx->bucketnum].lock)))++ == 0 ? 0 : 34) == 0(fctx->events).tail == (event)(fctx->events).head == (event)(--(*((&res->buckets[fctx->bucketnum].lock))) == 0 ? 0 : 34) == 0(res->whenshutdown).tail == (event)(res->whenshutdown).head == (event)empty_bucketres->activebuckets > 0fetchp != ((void *)0)destroyfetch((*((&res->buckets[bucketnum].lock)))++ == 0 ? 0 : 34) == 0event->fetch != fetchfctx->references > 0(--(*((&res->buckets[bucketnum].lock))) == 0 ? 0 : 34) == 0!res->exitingclients-per-query decreased to %usendeventsresult != 0 || dns_rdataset_isassociated(event->rdataset) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_any) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_rrsig) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_sig)event->result == (((1) << 16) + 51) || event->result == (((1) << 16) + 52)((*((&fctx->res->lock)))++ == 0 ? 0 : 34) == 0(--(*((&fctx->res->lock))) == 0 ? 0 : 34) == 0clients-per-query increased to %uexiting((*((&res->buckets[i].lock)))++ == 0 ? 0 : 34) == 0(--(*((&res->buckets[i].lock))) == 0 ? 0 : 34) == 0(((fctx)->attributes & 0x0008) != 0)(fctx->validators).tail == (validator)(fctx->validators).head == (validator)queryp != ((void *)0)!((void *)((query)->link.prev) != (void *)(-1))query->tcpsocket == ((void *)0)cancelquery!(((query)->attributes & 0x02) != 0)no_response(fctx->queries).tail == (query)(fctx->queries).head == (query)cancelqueries(fctx->altfinds).tail == (find)(fctx->altfinds).head == (find)(fctx->finds).tail == (find)(fctx->finds).head == (find)(fctx->altaddrs).tail == (addr)(fctx->altaddrs).head == (addr)(fctx->forwaddrs).tail == (addr)(fctx->forwaddrs).head == (addr)stopeverythingisc_timer_reset(): %sdoshutdownfctx->state == fetchstate_active || fctx->state == fetchstate_donefctx->want_shutdown(find->options & 0x00000008) == 0(find->list).tail == (best)(find->list).head == (best)ignoring blackholed / bogus server: ignoring multicast address: ignoring experimental address: ignoring IPv6 mapped IPV4 address: ignoring IPv6 compatibility IPV4 address: fctx %p(%s): %s %sresquery %p (fctx %p(%s)): %ssendtoo many timeouts resolving '%s' (in '%s'?): disabling EDNStoo many timeouts, setting EDNS size to 512noanswer_responsereferral to non-parentns_rdataset != ((void *)0)dns_name_countlabels(&fctx->domain) > 0clone_resultshevent->rdataset != ((void *)0)event->rdataset != ((void *)0)! (hevent->sigrdataset == ((void *)0) && event->sigrdataset != ((void *)0))add_bad() isc_time_now((&query->start)) == 0query->dispatch != ((void *)0)connecting via TCPfctx_starttimer(fctx) == 0!(((fctx)->attributes & 0x0004) != 0)getaddressestoo many restarts(((fctx->forwaddrs).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->altaddrs).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)no addressesbestaddrinfo != ((void *)0)(fctx->finds).tail == (best)(fctx->finds).head == (best)(fctx->altfinds).tail == (best)(fctx->altfinds).head == (best)addrwaitevent->ev_type == (((4) << 16) + 19)!(((fctx->validators).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)received validation completion event(fctx->validators).tail == (vevent->validator)(fctx->validators).head == (vevent->validator)((*((&fctx->res->buckets[fctx->bucketnum].lock)))++ == 0 ? 0 : 34) == 0vevent->rdataset->type == ((dns_rdatatype_t)dns_rdatatype_dname)validation failed(--(*((&fctx->res->buckets[fctx->bucketnum].lock))) == 0 ? 0 : 34) == 0fctx->validator == ((void *)0)nonexistence validation OKvalidation OKvevent->sigrdataset != ((void *)0)fctx->type == ((dns_rdatatype_t)dns_rdatatype_any) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_rrsig) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_sig)dns_name_copy(vevent->name, (&((&hevent->foundname)->name)), ((void *)0)) == 0fctx->state == fetchstate_initfctx->nqueries == 0finddonefctx->pending > 0!(((fctx)->attributes & 0x0008) != 0)(((query) != ((void *)0)) && (((const isc__magic_t *)(query))->magic == ((('Q') << 24 | ('!') << 16 | ('!') << 8 | ('!')))))connectedsenddone((query)->sends > 0)(valoptions & 2U) != 0cache_messagecheck-names %s %s/%s/%svalrdataset == ((void *)0) && valsigrdataset == ((void *)0)eresult == (((1) << 16) + 51) || eresult == (((1) << 16) + 52)warningeventp != ((void *)0)res->frozen(((nameservers) != ((void *)0)) && (((const isc__magic_t *)(nameservers))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))nameservers->type == ((dns_rdatatype_t)dns_rdatatype_ns)nameservers == ((void *)0)forwarders == ((void *)0)sigrdataset == ((void *)0) || !dns_rdataset_isassociated(sigrdataset)fetchp != ((void *)0) && *fetchp == ((void *)0)createfetch: %s %sfctx != ((void *)0)/dns_name_issubdomain(&fctx->name, &fctx->domain)isc_time_nowplusinterval: %sisc_timer_create: %sjoindns_resolver_primeres->primefetch == ((void *)0)primingres->priming((*((&res->primelock)))++ == 0 ? 0 : 34) == 0(--(*((&res->primelock))) == 0 ? 0 : 34) == 0event->ev_type == (((4) << 16) + 6)isc_time_now((&tnow)) == 0received packet: %.*sreceived NSID '%s' from %s(message->flags & 0x8000U) != 0((rdataset)->link.next) == ((void *)0)lame server resolving '%s' (in '%s'?): %scould not mark server as lame: %senforced delegation-only for '%s' (%s/%s/%s) from %sanswer_response!externalncache_messagefctx->rmessage->counts[1] == 0couldn't find a zonecutnameservers now above QDOMAINresendwait for validatorsuspending DS lookup to find parent's NS recordsresume_dslookupresuming DS lookupcontinuing to look for parent's NS recordsfevent->sigrdataset == ((void *)0)resp != ((void *)0)detachres->references > 0res->exiting && res->activebuckets == 0res->references == 0!res->primingres->nfctx == 0(*((&res->poollock)) == 0 ? (*((&res->poollock)) = -1, 0) : 34) == 0(*((&res->primelock)) == 0 ? (*((&res->primelock)) = -1, 0) : 34) == 0(*((&res->nlock)) == 0 ? (*((&res->nlock)) = -1, 0) : 34) == 0(*((&res->lock)) == 0 ? (*((&res->lock)) = -1, 0) : 34) == 0(((res->buckets[i].fctxs).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&res->buckets[i].lock)) == 0 ? (*((&res->buckets[i].lock)) = -1, 0) : 34) == 0(res->alternates).tail == (a)(res->alternates).head == (a)(((view) != ((void *)0)) && (((const isc__magic_t *)(view))->magic == ((('V') << 24 | ('i') << 16 | ('e') << 8 | ('w')))))ntasks > 0resp != ((void *)0) && *resp == ((void *)0)dispatchmgr != ((void *)0)dispatchv4 != ((void *)0) || dispatchv6 != ((void *)0)res%u0123456789abcdefisc_result_register() failed: %ulabel too longbad escapebad bitstringbitstring too longempty labelbad dotted quadinvalid NS owner name (wildcard)unknown class/typebad label typebad compression pointertoo many hopsdisallowed (by application policy)extra input textextra input datatext too longnot at top of zonesyntax errorbad checksumbad IPv6 addressno ownerno ttlbad classname too longpartial matchnew originunchangedbad ttlmore data needed/to be renderedcontinuedelegationgluebad databasebad zonemore datatsig verify failuretsig indicates errorRRSIG failed to verifyRRSIG has expiredRRSIG validity period has not begunkey is unauthorized to sign datainvalid timeexpected a TSIG or SIG(0)did not expect a TSIG or SIG(0)TKEY is unacceptablehintdropzone not loadedncache nxdomainncache nxrrsetnot verified yetno identityno journalaliasuse TCPno valid RRSIGno valid NSECnot insecureunknown servicerecoverable error occurredunknown opt attribute recordunexpected message idseen include filenot exactaddress blackholedbad algorithminvalid use of a meta typeCNAME and other datamultiple RRs of singleton typehint nxrrsetno master file configuredunknown protocolclocks are unsynchronizedIXFR failednot authoritativeno valid KEYobsoletealready frozenunknown flagexpected a responseno valid DSNS is an addressreceived FORMERRtruncated TCP responselame server detectedunexpected RCODEunexpected OPCODEchase DS serversempty nameempty wildbad bitmapfrom wildcardbad owner name (check-names)bad name (check-names)dynamic zoneunknown commandmust-be-securecovering NSEC record returnedMX is an addressduplicate query_default: view rootns.ccheckhints%s%s: %s/%s (%s) missing from hintscheckhints%s%s: %s/%s (%s) extra record in hints_bindhints != ((void *)0)checkhints%s%s: unable to get root NS rrset from hints: %scheckhints%s%s: unable to get root NS rrset from cache: %scheckhints%s%s: unable to find root NS '%s' in hintscheckhints%s%s: extra NS '%s' in hintstarget != ((void *)0) && *target == ((void *)0)extra data in root hints '%s'stats.c(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_generalcounter < stats->ncounters(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_rdtype(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_rdataset(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_opcodei < stats->ncounters(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t')))))statsp != ((void *)0) && *statsp == ((void *)0)((*((&stats->lock)))++ == 0 ? 0 : 34) == 0(--(*((&stats->lock))) == 0 ? 0 : 34) == 0(*((&stats->lock)) == 0 ? (*((&stats->lock)) = -1, 0) : 34) == 0statsp != ((void *)0) && (((*statsp) != ((void *)0)) && (((const isc__magic_t *)(*statsp))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t')))))referralnxrrsetnxdomainrecursionduplicatedropped%4d%2d%2d%2d%2d%2dtime.c%04d%02d%02d%02d%02d%02dtsig.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))(&source->refs)->refs > 0ringp != ((void *)0)*ringp != ((void *)0)*ringp == ((void *)0)(((key) != ((void *)0)) && (((const isc__magic_t *)(key))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))key->ring != ((void *)0)isc_rwlock_lock((&key->ring->lock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&key->ring->lock), (isc_rwlocktype_write)) == 0tsig key '%s' (%s): %stsig key '%s': %stsig expire: generated=%d, refs=%d, expire=%d)tsig expire: deletingtsigkey != ((void *)0)*tsigkey == ((void *)0)ring != ((void *)0)isc_rwlock_lock((&ring->lock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&ring->lock), (isc_rwlocktype_write)) == 0isc_rwlock_lock((&ring->lock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&ring->lock), (isc_rwlocktype_read)) == 0(&key->refs)->refs > 0(((dns_message_gettsigkey(msg)) != ((void *)0)) && (((const isc__magic_t *)(dns_message_gettsigkey(msg)))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))dns_rdatalist_tordataset(datalist, dataset) == 0keyp != ((void *)0)(((*keyp) != ((void *)0)) && (((const isc__magic_t *)(*keyp))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))(&key->refs)->refs == 0node != ((void *)0)key == ((void *)0) || *key == ((void *)0)algorithm != ((void *)0)key != ((void *)0) || ring != ((void *)0)the key '%s' is too short to be secure(&tkey->refs)->refs > 0(&tkey->refs)->refs == 0length >= 0secret != ((void *)0)tsigkey == ((void *)0) || (((tsigkey) != ((void *)0)) && (((const isc__magic_t *)(tsigkey))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))dns_message_gettsigkey(msg) != ((void *)0)msg->tcp_continuation == 1msg->querytsig != ((void *)0)key name and algorithm do not matchsignature is in the futuresignature is emptysignature failed to verify(2)unknown keysignature length to bigsignature length below minimumtruncated signature length too smallsignature length too smallsignature failed to verify(1)signature was empty%s%u %s%s%u%clen + 1 <= sizeof(tmp)ttl.cnp - nbuf <= (int)sizeof(nbuf)weekdayhourminutesecondx > 0accepted expired %sRRSIG (keyid=%u)verify rdataset (keyid=%u): %svalidator.cval->event == ((void *)0)%.*svalidating @%p: %s %s: %s%.*svalidator @%p: %s%s: creating %s for %s %smarking as answer(((val)->attributes & 0x0001) != 0)val->fetch == ((void *)0)(*((&val->lock)) == 0 ? (*((&val->lock)) = -1, 0) : 34) == 0validatorp != ((void *)0)(((val) != ((void *)0)) && (((const isc__magic_t *)(val))->magic == ((('V') << 24 | ('a') << 16 | ('l') << 8 | ('?')))))((*((&val->lock)))++ == 0 ? 0 : 34) == 0dns_validator_destroy(--(*((&val->lock))) == 0 ? 0 : 34) == 0(((validator) != ((void *)0)) && (((const isc__magic_t *)(validator))->magic == ((('V') << 24 | ('a') << 16 | ('l') << 8 | ('?')))))((*((&validator->lock)))++ == 0 ? 0 : 34) == 0dns_validator_cancel(--(*((&validator->lock))) == 0 ? 0 : 34) == 0(validator->options & 2U) != 0dlv_validator_startrdataset != ((void *)0) || (rdataset == ((void *)0) && sigrdataset == ((void *)0) && message != ((void *)0))validatorp != ((void *)0) && *validatorp == ((void *)0)DNS_R_COVERINGNSECtype == ((dns_rdatatype_t)dns_rdatatype_dlv)covering nsec: trust %ucovering nsec: for parentcovering nsec: not in zonecovering nsec: not in rangecovering nsec found: '%s' '%s' '%s'continuing validation would lead to deadlock: aborting validationval->view->dlv != ((void *)0)must be secure failureDLV concatenate failedlooking for DLV %sfinddlvsep!((val->attributes & 0x0020) != 0)plain DNSSEC returns unsecure (%s): looking for DLVDLV not foundDLV lookup: %sDLV %s foundexists != ((void *)0)nsecset != ((void *)0) && nsecset->type == ((dns_rdatatype_t)dns_rdatatype_nsec)failure processing NSEC setlooking for relevant nsecNSEC does not cover name, before NSECignoring parent nsecignoring child nsecnsec proves name exists (owner) data=%dNSEC proves CNAME existsignoring nsec matches next nameignoring nsec because name is past end of rangensec proves name exist (empty)failure generating wildcard namensec range okwildcard val->key == ((void *)0)dlv_validatezonekeydns_ds_buildrdata() -> %sFound matching DLV record: checking for signaturemarking as secureno supported algorithm/digest (dlv)signed by trusted key; marking as secureunable to find a DNSKEY which verifies the DNSKEY RRset and also matches one of specified trusted-keys for '%s'unsigned DS recordno DS recordval->dsset != ((void *)0)no supported algorithm/digest (DS)no DNSKEY matching DLVno RRSIG matching DLV keyno DNSKEY matching DSno RRSIG matching DS keydbresult == (((3) << 16) + 8) || dbresult == (((1) << 16) + 52)set.type == ((dns_rdatatype_t)dns_rdatatype_nsec)not beneath secure rootresuming proveunsecuremust be secure failure at '%s'no supported algorithm/digest (%s/DS)checking existence of DS at '%s'proveunsecureinsecurity proof failedresuming nsecvalidatensecvalidatenoqname proof foundnoqname proof not foundin checkwildcard: %snonexistence proof(s) foundnonexistence proof(s) not foundresuming validateget_keykeyset with trust %dno message available for noqname prooflooking for noqname proofverify failure: %sfailed to iterate signatures: %sno valid signature foundfailed to verify rdatasetevent->ev_type == (((4) << 16) + 21)restarting using DLVstartingattempting positive response validationdns_rdataset_isassociated(val->event->rdataset)dns_rdataset_isassociated(val->event->sigrdataset)rdataset->type == ((dns_rdatatype_t)dns_rdatatype_dnskey)falling back to insecurity proofattempting insecurity proofattempting negative response validationval->event != ((void *)0)in dlvfetched: %sin authvalidatedauthvalidated: got %sin dsvalidateddsset with trust %ddsvalidated: got %sin keyvalidatedkeyvalidated: got %sin dsfetched2: %sin dsfetchedfalling back to insecurity proof (%s)dsfetched: got %sin fetch_callback_validatorfetch_callback_validator: got %s *view.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('V') << 24 | ('i') << 16 | ('e') << 8 | ('w')))))(&source->references)->refs > 0!view->frozenview->resquerystats == ((void *)0)view->resstats == ((void *)0); ; Cache dump of view '%s' ; keyp != ((void *)0) && *keyp == ((void *)0)list != ((void *)0)result == 0 || result == 23 || result == (((1) << 16) + 23)view->frozentype != ((dns_rdatatype_t)dns_rdatatype_rrsig)nodep == ((void *)0) || *nodep == ((void *)0)view->cachedb != ((void *)0)view->hints == ((void *)0)dns_db_iszone(hints)(((view->cachedb) != ((void *)0)) && (((const isc__magic_t *)(view->cachedb))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))view->resolver == ((void *)0)ADB!((void *)((view)->link.prev) != (void *)(-1))((unsigned int)((&view->references)->refs)) == 0view->weakrefs == 0(((view)->attributes & 0x01) != 0)(((view)->attributes & 0x02) != 0)(((view)->attributes & 0x04) != 0)(view->delonly[i]).tail == (name)(view->delonly[i]).head == (name)(view->rootexclude[i]).tail == (name)(view->rootexclude[i]).head == (name)(*((&view->lock)) == 0 ? (*((&view->lock)) = -1, 0) : 34) == 0(&view->references)->refs == 0viewp != ((void *)0)((*((&view->lock)))++ == 0 ? 0 : 34) == 0view->weakrefs > 0(--(*((&view->lock))) == 0 ? 0 : 34) == 0(&view->references)->refs > 0viewp != ((void *)0) && *viewp == ((void *)0)dns_zt_create() failed: %sdns_keytable_create() failed: %sdns_fwdtable_create() failed: %sevent->ev_type == (((4) << 16) + 22)view->task == taskevent->ev_type == (((4) << 16) + 3)event->ev_type == (((4) << 16) + 2)transferred zone has %d SOA record%stransferred zone has no NS recordszone->expirezone->refresh: TSIG '%s'transferred serial %u%stransfer: could not set file modification time of '%s': %sisc_rwlock_lock((&zone->zmgr->rwlock), (isc_rwlocktype_write)) == 0(zone->zmgr->xfrin_in_progress).tail == (zone)(zone->zmgr->xfrin_in_progress).head == (zone)isc_rwlock_unlock((&zone->zmgr->rwlock), (isc_rwlocktype_write)) == 0zone.c(((zone) != ((void *)0)) && (((const isc__magic_t *)(zone))->magic == ((('Z') << 24 | ('O') << 16 | ('N') << 8 | ('E')))))((zone)->locked)((unsigned int)((&zone->erefs)->refs)) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('Z') << 24 | ('O') << 16 | ('N') << 8 | ('E')))))(&source->erefs)->refs > 0((source)->locked)source->irefs + ((unsigned int)((&source->erefs)->refs)) > 0source->irefs != 0zonep != ((void *)0) && (((*zonep) != ((void *)0)) && (((const isc__magic_t *)(*zonep))->magic == ((('Z') << 24 | ('O') << 16 | ('N') << 8 | ('E')))))((*zonep)->locked)zone->irefs > 0zone->irefs + ((unsigned int)((&zone->erefs)->refs)) > 0val > 0next != ((void *)0) && *next == ((void *)0)(((zmgr) != ((void *)0)) && (((const isc__magic_t *)(zmgr))->magic == ((('Z') << 24 | ('m') << 16 | ('g') << 8 | ('r')))))first != ((void *)0) && *first == ((void *)0)iolimit > 0((*((&(zone)->lock)))++ == 0 ? 0 : 34) == 0(zone)->locked == isc_boolean_false(--(*((&(zone)->lock))) == 0 ? 0 : 34) == 0((*((&(source)->lock)))++ == 0 ? 0 : 34) == 0(source)->locked == isc_boolean_false(--(*((&(source)->lock))) == 0 ? 0 : 34) == 0type != dns_zone_nonezone->type == dns_zone_none || zone->type == typeisc_rwlock_lock((&zmgr->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&zmgr->rwlock), (isc_rwlocktype_read)) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('Z') << 24 | ('m') << 16 | ('g') << 8 | ('r')))))isc_rwlock_lock((&source->rwlock), (isc_rwlocktype_write)) == 0source->refs > 0isc_rwlock_unlock((&source->rwlock), (isc_rwlocktype_write)) == 0%s: zone %s: %s%s/%s: %s%s/%s: %s: %s zone->stats == ((void *)0)isc_rwlock_lock((&zmgr->rwlock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&zmgr->rwlock), (isc_rwlocktype_write)) == 0(((io) != ((void *)0)) && (((const isc__magic_t *)(io))->magic == ((('Z') << 24 | ('m') << 16 | ('I') << 8 | ('O')))))((*((&io->zmgr->iolock)))++ == 0 ? 0 : 34) == 0(io->zmgr->high).tail == (io)(io->zmgr->high).head == (io)(io->zmgr->low).tail == (io)(io->zmgr->low).head == (io)io->event != ((void *)0)(--(*((&io->zmgr->iolock))) == 0 ? 0 : 34) == 0zone->statelist == &zmgr->waiting_for_xfrin(zmgr->waiting_for_xfrin).tail == (zone)(zmgr->waiting_for_xfrin).head == (zone)Transfer started.starting zone transfer: %sisc_rwlock_lock((&zmgr->rwlock), (locktype)) == 0isc_rwlock_unlock((&zmgr->rwlock), (locktype)) == 0zone != ((void *)0)NS '%s' has no address records (A or AAAA)NS '%s' is a CNAME (illegal)NS '%s' is below a DNAME '%s' (illegal)zone->db != ((void *)0)((*((&zone->dblock)))++ == 0 ? 0 : 34) == 0(--(*((&zone->dblock))) == 0 ? 0 : 34) == 0expired!isc_time_isepoch(&zone->dumptime)!isc_time_isepoch(&zone->refreshtime)!isc_time_isepoch(&zone->expiretime)settimer inactivecould not deactivate zone timer: %scould not reset zone timer: %szone_settimerenterisc_time_now((&now)) == 0cancel_refreshepoch approaching: upgrade required: now + %s faileddns_zone_maintenancequeue_soa_query(soardataset != ((void *)0) && stub == ((void *)0)) || (soardataset == ((void *)0) && stub != ((void *)0))stub == ((void *)0) || (((stub) != ((void *)0)) && (((const isc__magic_t *)(stub))->magic == ((('S') << 24 | ('t') << 16 | ('u') << 8 | ('b')))))zone->db_argc >= 1refreshing stub: could not create database: %srefreshing stub: dns_db_findnode() failed: %srefreshing stub: dns_db_addrdataset() failed: %szone->masterscnt > 0zone->curmaster < zone->masterscntunable to find key: %sunable to add opt record: %sdns_request_createvia() failed: %sns_querydbargc >= 1dbargv != ((void *)0)zone->db == ((void *)0) && db != ((void *)0)dns_acache_setdb() failed: %siop != ((void *)0)!((void *)((io)->link.prev) != (void *)(-1))io->event == ((void *)0)((*((&zmgr->iolock)))++ == 0 ? 0 : 34) == 0zmgr->ioactive > 0(zmgr->high).tail == (next)(zmgr->high).head == (next)(zmgr->low).tail == (next)(zmgr->low).head == (next)next->event != ((void *)0)(--(*((&zmgr->iolock))) == 0 ? 0 : 34) == 0zmgr->refs == 0(((zmgr->zones).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&zmgr->iolock)) == 0 ? (*((&zmgr->iolock)) = -1, 0) : 34) == 0zmgrp != ((void *)0)zone->zmgr == zmgr(zmgr->zones).tail == (zone)(zmgr->zones).head == (zone)zone->zmgr == ((void *)0)zone->task == ((void *)0)zone->timer == ((void *)0)zone->irefs != 0iop != ((void *)0) && *iop == ((void *)0)zone_dumpnotifyp != ((void *)0) && *notifyp == ((void *)0)zmgr((*((&(forward->zone)->lock)))++ == 0 ? 0 : 34) == 0(forward->zone)->locked == isc_boolean_false(--(*((&(forward->zone)->lock))) == 0 ? 0 : 34) == 0table != ((void *)0)*table == ((void *)0)has %d SOA recordshas no NS recordsretrieving SOA and NS records failed: %sgenerating diffsixfr-from-differences: unable to get new serialixfr-from-differences: failed: new serial (%u) out of range [%u - %u]dns_journal_compact: %sdns_journal_compact failed: %sdumping new zone versionisc_time_now((&zone->loadtime)) == 0removing journal filereplacing zone databasebuf != ((void *)0)length > 1Uorigin != ((void *)0)rdclass != ((dns_rdataclass_t)dns_rdataclass_none)zone->rdclass == ((dns_rdataclass_t)dns_rdataclass_none) || zone->rdclass == rdclasscannot refresh: no mastersisc_time_nowplusinterval() failed: %sdns_zone_dialupnotify = %d, refresh = %dNOTIFY with no question section from: %sNOTIFY zone does not matchrefused notify from non-master: %snotify from %s: zone is up to datenotify from %s: refresh in progress, refresh check queuedcount == 0 || masters != ((void *)0)count == 0 || notify != ((void *)0)zone->irefs == 0!((zone)->locked)zone->readio == ((void *)0)zone->statelist == ((void *)0)zone->writeio == ((void *)0)dns_zone_setmasterswithkeys(zone, ((void *)0), ((void *)0), 0) == 0dns_zone_setalsonotify(zone, ((void *)0), 0) == 0(*((&zone->dblock)) == 0 ? (*((&zone->dblock)) = -1, 0) : 34) == 0(*((&zone->lock)) == 0 ? (*((&zone->lock)) = -1, 0) : 34) == 0(&zone->erefs)->refs == 0zone transfer finished: %s(zone->flags & 0x00000001U) != 0task == zone->taskgot_transfer_quota: skipping zone transfer as master %s (source %s) is unreachable (cached)no database exists yet, requesting AXFR of initial version from %sixfr-from-differences set, requesting AXFR from %sforced reload, requesting AXFR of initial version from %sretrying with AXFR from %s due to previous IXFR failureIXFR disabled, requesting AXFR from %srequesting IXFR from %scould not get TSIG key for zone transfer: %sisc_sockaddr_pf(&masteraddr) == isc_sockaddr_pf(&sourceaddr)callback != ((void *)0)(((forward) != ((void *)0)) && (((const isc__magic_t *)(forward))->magic == ((('F') << 24 | ('o') << 16 | ('r') << 8 | ('w')))))could not forward dynamic update to %s: %sforwarding dynamic update: unexpected response: master %s returned: %.*sexhausted dynamic update forwarder listforward_callbackdns_request_createvia2() failed: %ssoa_queryrefresh: timeout retrying without EDNS master %s (source %s)refresh: retry limit for master %s exceeded (source %s)refresh: skipped tcp fallbackas master %s (source %s) is unreachable (cached)refresh: failure trying master %s (source %s): %srefresh: rcode (%.*s) retrying without EDNS master %s (source %s)refresh: unexpected rcode (%.*s) from master %s (source %s)refresh: truncated UDP answer, initiating TCP zone xfer for master %s (source %s)zone->type == dns_zone_stubrefresh: truncated TCP response from master %s (source %s)refresh: non-authoritative answer from master %s (source %s)refresh: CNAME at top of zone in master %s (source %s)refresh: referral response from master %s (source %s)refresh: NODATA response from master %s (source %s)refresh: answer SOA count (%d) != 1 from master %s (source %s)refresh: unable to get SOA record from master %s (source %s)refresh: dns_rdataset_first() failedserial: new %u, old %uzone transferNS queryrefresh: skipping %s as master %s (source %s) is unreachable (cached)zone transfer deferred due to quotarefresh: could not set file modification time of '%s': %sserial number (%u) received from master %s < ours (%u)aheadrefresh_callbackqueue_xfrin(((stub) != ((void *)0)) && (((const isc__magic_t *)(stub))->magic == ((('S') << 24 | ('t') << 16 | ('u') << 8 | ('b')))))refreshing stub: timeout retrying without EDNS master %s (source %s)could not refresh stub from master %s (source %s): %srefreshing stub: rcode (%.*s) retrying without EDNS master %s (source %s)refreshing stub: unexpected rcode (%.*s) from %s (source %s)refreshing stub: truncated TCP response from master %s (source %s)refreshing stub: non-authoritative answer from master %s (source %s)refreshing stub: unexpected CNAME response from master %s (source %s)refreshing stub: no NS records in response from master %s (source %s)stub->db == ((void *)0)stub->version == ((void *)0)refreshing stub: unable to save NS records from master %s (source %s)stub_callback(((notify) != ((void *)0)) && (((const isc__magic_t *)(notify))->magic == ((('N') << 24 | ('t') << 16 | ('f') << 8 | ('y')))))((*((&(notify->zone)->lock)))++ == 0 ? 0 : 34) == 0(notify->zone)->locked == isc_boolean_false((notify->zone)->locked)(notify->zone->notifies).tail == (notify)(notify->zone->notifies).head == (notify)(--(*((&(notify->zone)->lock))) == 0 ? 0 : 34) == 0task == notify->zone->tasknotify response from %s: %.*snotify to %s failed: %snotify to %s: retries exceedednotify: ignoring IPv6 mapped IPV4 address: %smessagep != ((void *)0) && *messagep == ((void *)0)sending notify to %sdump failed: %szone->notifydelaysending notifies (serial %u)zone_timerdump_donezone_gotwritehandle(&zone->erefs)->refs > 0zone->view == ((void *)0)REQUIRED GLUE SIBLING GLUE %s/NS '%s' has no %saddress records (A or AAAA)%s/NS '%s' is a CNAME (illegal)%s/NS '%s' is below a DNAME '%s' (illegal)%s/MX '%s' has no address records (A or AAAA)%s/MX '%s' is a CNAME (illegal)%s/MX '%s' is below a DNAME '%s' (illegal)%s/SRV '%s' has no address records (A or AAAA)%s/SRV '%s' is a CNAME (illegal)%s/SRV '%s' is below a DNAME '%s' (illegal)saved '%s' as '%s'no master fileloading from master file %s failed: %snumber of nodes in database: %ujournal rollforward failed: %sjournal rollforward failed: journal out of sync with zonejournal rollforward completed successfully: %sloadedcould not find NS and/or SOA recordszone->type == dns_zone_masterixfr-from-differences: new serial (%u) out of range [%u - %u]zone serial has gone backwardszone serial unchanged. zone may fail to transfer to slaves.zone->retryunexpected zone type %dweak %s (%u) key found (exponent=3) (signed)loaded serial %u%sjn-XXXXXXXXdb-XXXXXXXX(((load) != ((void *)0)) && (((const isc__magic_t *)(load))->magic == ((('L') << 24 | ('o') << 16 | ('a') << 8 | ('d')))))((*((&(load->zone)->lock)))++ == 0 ? 0 : 34) == 0(load->zone)->locked == isc_boolean_false((load->zone)->locked)(--(*((&(load->zone)->lock))) == 0 ? 0 : 34) == 0zone->type != dns_zone_noneisc_time_now((&loadtime)) == 0skipping load: master file older than last load_builtinrbt64starting loadloading zone: creating database: %sloading zone: no master file configuredloading zone: no master file configured: continuingargv != ((void *)0) && *argv == ((void *)0).jnlacache != ((void *)0)_toolongzonep != ((void *)0) && *zonep == ((void *)0)event->ev_type == (((4) << 16) + 17)zone_shutdown(zone->zmgr->waiting_for_xfrin).tail == (zone)(zone->zmgr->waiting_for_xfrin).head == (zone)freezingthawing%s zone '%s/%s'%s%s: %szt.c(((zt) != ((void *)0)) && (((const isc__magic_t *)(zt))->magic == ((('Z') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))action != ((void *)0)isc_rwlock_lock((&zt->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&zt->rwlock), (isc_rwlocktype_read)) == 0ztp != ((void *)0) && *ztp == ((void *)0)isc_rwlock_lock((&zt->rwlock), (isc_rwlocktype_write)) == 0zt->references > 0zt->references != 0isc_rwlock_unlock((&zt->rwlock), (isc_rwlocktype_write)) == 0ztp != ((void *)0) && (((*ztp) != ((void *)0)) && (((const isc__magic_t *)(*ztp))->magic == ((('Z') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))+%03d+%05d%sdst_api.cdst_initialized == isc_boolean_true(((dctx) != ((void *)0)) && (((const isc__magic_t *)(dctx))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('C')))))dctx->key->func->adddata != ((void *)0)(((key1) != ((void *)0)) && (((const isc__magic_t *)(key1))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))(((key2) != ((void *)0)) && (((const isc__magic_t *)(key2))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))(((key) != ((void *)0)) && (((const isc__magic_t *)(key))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))key->func->isprivate != ((void *)0)(((pub) != ((void *)0)) && (((const isc__magic_t *)(pub))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K'))))) && (((priv) != ((void *)0)) && (((const isc__magic_t *)(priv))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))sig != ((void *)0)out != ((void *)0).private.keytype == 0x2000000 || type == 0x4000000 || type == 0keyp != ((void *)0) && (((*keyp) != ((void *)0)) && (((const isc__magic_t *)(*keyp))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))key->func->destroy != ((void *)0)dctxp != ((void *)0) && (((*dctxp) != ((void *)0)) && (((const isc__magic_t *)(*dctxp))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('C')))))dctx->key->func->destroyctx != ((void *)0)dctxp != ((void *)0) && *dctxp == ((void *)0)dns_name_isabsolute(name)gssctx != ((void *)0)!dst_key_isprivate(key)dst_initialized%.*s%s(type & (0x2000000 | 0x4000000)) != 0 KEY DNSKEY mctx != ((void *)0) && ectx != ((void *)0)dst_initialized == isc_boolean_falsedst_result.calgorithm is unsupportedopenssl failurebuilt with no crypto supportillegal operation for a null keypublic key is invalidprivate key is invalidUNUSED6error occurred writing key to diskinvalid algorithm specific parameterUNUSED9UNUSED10sign failureUNUSED12UNUSED13verify failurenot a public keynot a private keynot a key that can compute a secretfailure computing a shared secretno randomness availablebad key typehmac_link.cfuncp != ((void *)0)key->keydata.hmacsha512 != ((void *)0)key->keydata.hmacsha384 != ((void *)0)key->keydata.hmacsha256 != ((void *)0)key->keydata.hmacsha224 != ((void *)0)key->keydata.hmacsha1 != ((void *)0)key->keydata.hmacmd5 != ((void *)0)source->length >= 4dst_key_sigsize(key, &maxbits) == 0bits <= maxbitsacache.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('A') << 24 | ('C') << 16 | ('H') << 8 | ('E')))))(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))(((acache) != ((void *)0)) && (((const isc__magic_t *)(acache))->magic == ((('A') << 24 | ('C') << 16 | ('H') << 8 | ('E')))))((*((&acache->lock)))++ == 0 ? 0 : 34) == 0!acache->cevent_sent(--(*((&acache->lock))) == 0 ? 0 : 34) == 0((cleaner)->state == cleaner_s_idle && (cleaner)->resched_event != ((void *)0))cleaner->current_entry == ((void *)0)begin acache cleaning, mem inuse %luevent->ev_type == (((4) << 16) + 40)cleaner->overmem_event == ((void *)0)overmem_cleaning_action called, overmem = %d, state = %d((*((&cleaner->lock)))++ == 0 ? 0 : 34) == 0(--(*((&cleaner->lock))) == 0 ? 0 : 34) == 0lowhighacache memory reaches %s watermark, mem inuse %lu((*((&acache->cleaner.lock)))++ == 0 ? 0 : 34) == 0(--(*((&acache->cleaner.lock))) == 0 ? 0 : 34) == 0could not set acache cleaning interval: %sacache %p cleaning interval set to %d.(((entry) != ((void *)0)) && (((const isc__magic_t *)(entry))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))(entry->foundname->list).tail == (rdataset)(entry->foundname->list).head == (rdataset)entry->db != ((void *)0)dbentryp != ((void *)0) && *dbentryp == ((void *)0)ent->origdb != ((void *)0)(dbent->originlist).tail == (ent)(dbent->originlist).head == (ent)ent->db != ((void *)0)(dbent->referlist).tail == (ent)(dbent->referlist).head == (ent)((*((&acache->entrylocks[entry->locknum])))++ == 0 ? 0 : 34) == 0(--(*((&acache->entrylocks[entry->locknum]))) == 0 ? 0 : 34) == 0((*((&acache->entrylocks[locknum])))++ == 0 ? 0 : 34) == 0entry->foundname != ((void *)0)(--(*((&acache->entrylocks[locknum]))) == 0 ? 0 : 34) == 0(fname->list).tail == (erdataset)(fname->list).head == (erdataset)entryp != ((void *)0) && *entryp == ((void *)0)origdb != ((void *)0)event->ev_type == (((1) << 16) + 1)acache cleaning timer fired, cleaner state = %d(*((&acache->entrylocks[i])) == 0 ? (*((&acache->entrylocks[i])) = -1, 0) : 34) == 0(*((&acache->cleaner.lock)) == 0 ? (*((&acache->cleaner.lock)) = -1, 0) : 34) == 0(*((&acache->lock)) == 0 ? (*((&acache->lock)) = -1, 0) : 34) == 0acachep != ((void *)0) && (((*acachep) != ((void *)0)) && (((const isc__magic_t *)(*acachep))->magic == ((('A') << 24 | ('C') << 16 | ('H') << 8 | ('E')))))(&acache->refs)->refs > 0check_noentry(acache) == isc_boolean_trueentryp != ((void *)0) && (((*entryp) != ((void *)0)) && (((const isc__magic_t *)(*entryp))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))(&entry->references)->refs > 0!((void *)((entry)->link.prev) != (void *)(-1))(dbentry->originlist).tail == (entry)(dbentry->originlist).head == (entry)(acache->entries).tail == (entry)(acache->entries).head == (entry)(dbentry->referlist).tail == (entry)(dbentry->referlist).head == (entry)(((dbentry->originlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false) && (((dbentry->referlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(acache->dbbucket[bucket]).tail == (dbentry)(acache->dbbucket[bucket]).head == (dbentry)((cleaner)->state == cleaner_s_busy && (cleaner)->resched_event == ((void *)0))(((cleaner->current_entry) != ((void *)0)) && (((const isc__magic_t *)(cleaner->current_entry))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))cleaner->current_entry->callback == ((void *)0)(acache->entries).tail == (cleaner->current_entry)(acache->entries).head == (cleaner->current_entry)acache %p stats: hits=%d misses=%d queries=%d adds=%d deleted=%d cleaned=%d cleaner_runs=%d overmem=%d overmem_nocreates=%d nomem=%dend acache cleaning, %lu entries cleaned, mem inuse %luacache is still in overmem state after cleaningtask == acache->taskevent->ev_type == (((4) << 16) + 39)now32 > last32entry != ((void *)0)acache cleaner: still overmem, reset and try againnext != ((void *)0) && next != cleaner->current_entryacache cleaner: checked %d entries, mem inuse %lu, sleepingacache->shutting_down(((dbent->originlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false) && (((dbent->referlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(acache->dbbucket[i]).tail == (dbent)(acache->dbbucket[i]).head == (dbent)acache->dbentries == 0acachep != ((void *)0) && *acachep == ((void *)0)taskmgr != ((void *)0)isc_task_create() failed(): %sacachetaskacache cleaner: isc_task_onshutdown() failed: %sisc_timer_create() failed: %s(*((&cleaner->lock)) == 0 ? (*((&cleaner->lock)) = -1, 0) : 34) == 0(&acache->refs)->refs == 0event->ev_type == (((0) << 16) + 1)acache->live_cleaners == 0acl.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('a') << 16 | ('c') << 8 | ('l')))))(&source->refcount)->refs > 0((*((&insecure_prefix_lock)))++ == 0 ? 0 : 34) == 0(--(*((&insecure_prefix_lock))) == 0 ? 0 : 34) == 0(((acl) != ((void *)0)) && (((const isc__magic_t *)(acl))->magic == ((('D') << 24 | ('a') << 16 | ('c') << 8 | ('l')))))(&acl->refcount)->refs > 0(&dacl->refcount)->refs == 0reqaddr != ((void *)0)matchelt == ((void *)0) || *matchelt == ((void *)0)adb.cbucket != (-1)(adb->names[bucket]).tail == (name)(adb->names[bucket]).head == (name)adb->name_refcnt[bucket] > 0(adb->entries[bucket]).tail == (entry)(adb->entries[bucket]).head == (entry)adb->entry_refcnt[bucket] > 0(((adb) != ((void *)0)) && (((const isc__magic_t *)(adb))->magic == ((('D') << 24 | ('a') << 16 | ('d') << 8 | ('b')))))(((addr) != ((void *)0)) && (((const isc__magic_t *)(addr))->magic == ((('a') << 24 | ('d') << 16 | ('A') << 8 | ('I')))))((*((&adb->entrylocks[bucket])))++ == 0 ? 0 : 34) == 0(--(*((&adb->entrylocks[bucket]))) == 0 ? 0 : 34) == 0adbx != ((void *)0) && *adbx == ((void *)0)((*((&adb->reflock)))++ == 0 ? 0 : 34) == 0(--(*((&adb->reflock))) == 0 ? 0 : 34) == 0(((find) != ((void *)0)) && (((const isc__magic_t *)(find))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('H')))))((*((&find->lock)))++ == 0 ? 0 : 34) == 0(--(*((&find->lock))) == 0 ? 0 : 34) == 0adb reached %s water mark((*((&adb->overmemlock)))++ == 0 ? 0 : 34) == 0(--(*((&adb->overmemlock))) == 0 ? 0 : 34) == 0dns_adb_cancelfind on find %p!(((find)->flags & 0x80000000) != 0)(((find)->options & 0x00000008) != 0)(--(*((have))) == 0 ? 0 : 34) == 0((*((want)))++ == 0 ? 0 : 34) == 0((*((have)))++ == 0 ? 0 : 34) == 0(find->adbname->finds).tail == (find)(find->adbname->finds).head == (find)(--(*((&adb->namelocks[unlock_bucket]))) == 0 ? 0 : 34) == 0sending event %p to task %p for find %padb->irefcnt > 0(adb->whenshutdown).tail == (event)(adb->whenshutdown).head == (event)ENTER clean_finds_at_name, name %p, evtype %08x, addrs %08xDNS_EVENT_ADBMOREADDRESSESDNS_EVENT_ADBNOMOREADDRESSEScfan: processing find %p(name->finds).tail == (find)(name->finds).head == (find)!(((find)->flags & 0x40000000) != 0)EXIT clean_finds_at_name, name %pcfan: skipping find %painfo != ((void *)0) && (((*ainfo) != ((void *)0)) && (((const isc__magic_t *)(*ainfo))->magic == ((('a') << 24 | ('d') << 16 | ('A') << 8 | ('I')))))ai->entry == ((void *)0)!((void *)((ai)->publink.prev) != (void *)(-1))findp != ((void *)0) && (((*findp) != ((void *)0)) && (((const isc__magic_t *)(*findp))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('H')))))!(!((((find)->list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false))!((void *)((find)->publink.prev) != (void *)(-1))!((void *)((find)->plink.prev) != (void *)(-1))find->name_bucket == (-1)find->adbname == ((void *)0)(*((&find->lock)) == 0 ? (*((&find->lock)) = -1, 0) : 34) == 0namehook != ((void *)0) && (((*namehook) != ((void *)0)) && (((const isc__magic_t *)(*namehook))->magic == ((('a') << 24 | ('d') << 16 | ('N') << 8 | ('H')))))nh->entry == ((void *)0)!((void *)((nh)->plink.prev) != (void *)(-1))lameinfo != ((void *)0) && (((*lameinfo) != ((void *)0)) && (((const isc__magic_t *)(*lameinfo))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('Z')))))!((void *)((li)->plink.prev) != (void *)(-1))(entry->lameinfo).tail == (li)(entry->lameinfo).head == (li)entry != ((void *)0) && (((*entry) != ((void *)0)) && (((const isc__magic_t *)(*entry))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('E')))))e->lock_bucket == (-1)e->refcnt == 0!((void *)((e)->plink.prev) != (void *)(-1))(e->lameinfo).tail == (li)(e->lameinfo).head == (li)cleaning entry bucket %dresult == isc_boolean_falseentryp != ((void *)0) && (((*entryp) != ((void *)0)) && (((const isc__magic_t *)(*entryp))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('E')))))killing entry %p((void *)((entry)->plink.prev) != (void *)(-1))entry->refcnt > 0(((namehook) != ((void *)0)) && (((const isc__magic_t *)(namehook))->magic == ((('a') << 24 | ('d') << 16 | ('N') << 8 | ('H')))))(((entry) != ((void *)0)) && (((const isc__magic_t *)(entry))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('E')))))(--(*((&adb->entrylocks[addr_bucket]))) == 0 ? 0 : 34) == 0((*((&adb->entrylocks[addr_bucket])))++ == 0 ? 0 : 34) == 0(*namehooks).tail == (namehook)(*namehooks).head == (namehook)name != ((void *)0) && (((*name) != ((void *)0)) && (((const isc__magic_t *)(*name))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))!(!((((n)->v4).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false))!(!((((n)->v6).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false))!((((n)->fetch_a != ((void *)0))) || (((n)->fetch_aaaa != ((void *)0))))(((n->finds).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)!((void *)((n)->plink.prev) != (void *)(-1))n->lock_bucket == (-1)n->adb == adb(((name) != ((void *)0)) && (((const isc__magic_t *)(name))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))expiring v4 for name %pexpiring v6 for name %pkilling name %p((*((&adb->lock)))++ == 0 ? 0 : 34) == 0((*((&adb->namelocks[bucket])))++ == 0 ? 0 : 34) == 0kill_name(&adbname, (((4) << 16) + 10), isc_boolean_true) == isc_boolean_false(--(*((&adb->namelocks[bucket]))) == 0 ? 0 : 34) == 0(--(*((&adb->lock))) == 0 ? 0 : 34) == 0namep != ((void *)0) && (((*namep) != ((void *)0)) && (((const isc__magic_t *)(*namep))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))cleaning name bucket %dcleanup_names(adb, i, 2147483647) == isc_boolean_falsecleanup_entries(adb, i, 2147483647) == isc_boolean_falsefactor <= 10!adb->cevent_sentaddrp != ((void *)0)dns_adb_destroyfind on find %p(((find)->flags & 0x80000000) != 0)(find->list).tail == (ai)(find->list).head == (ai)dec_entry_refcnt(adb, entry, isc_boolean_true) == isc_boolean_falseadbx != ((void *)0) && (((*adbx) != ((void *)0)) && (((const isc__magic_t *)(*adbx))->magic == ((('D') << 24 | ('a') << 16 | ('d') << 8 | ('b')))))adb->erefcnt > 0adb->shutting_down(--(*((&adb->entrylocks[*bucketp]))) == 0 ? 0 : 34) == 0addrp != ((void *)0) && *addrp == ((void *)0)findaddrinfo: new entry %pfindaddrinfo: found entry %pqname != ((void *)0) Fetch(%s): %p -> { nh %p, entry %p, fetch %p } [%s TTL %d];Find %p ; qpending %08x partial %08x options %08x flags %08x ; name_bucket %d, name %p, event sender %p Addresses: UnkFamilyBadAddress entry %p, flags %08x srtt %u addr %s f != ((void *)0); %p: refcnt %u ; %s [srtt %u] [flags %08x] [ttl %d]; %s [lame TTL %d] ; Hook(%s) %p cleanup_names(adb, i, now) == isc_boolean_falsecleanup_entries(adb, i, now) == isc_boolean_false; ; Address database dump ; ((*((&adb->namelocks[i])))++ == 0 ? 0 : 34) == 0((*((&adb->entrylocks[i])))++ == 0 ? 0 : 34) == 0; alias v4v6target [v4 %s] [v6 %s]; ; Unassociated entries ; (--(*((&adb->entrylocks[i]))) == 0 ? 0 : 34) == 0(--(*((&adb->namelocks[i]))) == 0 ? 0 : 34) == 0fetch != ((void *)0) && (((*fetch) != ((void *)0)) && (((const isc__magic_t *)(*fetch))->magic == ((('a') << 24 | ('d') << 16 | ('F') << 8 | ('4')))))(((adbname) != ((void *)0)) && (((const isc__magic_t *)(adbname))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))(rdtype == ((dns_rdatatype_t)dns_rdatatype_a)) || (rdtype == ((dns_rdatatype_t)dns_rdatatype_aaaa))rdata.length == 4rdata.length == 16nh == ((void *)0)expire_v4 set to MIN(%u,%u) import_rdatasetexpire_v6 set to MIN(%u,%u) import_rdatasetdns_name_countlabels(target) == 0rdtype == ((dns_rdatatype_t)dns_rdatatype_a) || rdtype == ((dns_rdatatype_t)dns_rdatatype_aaaa)adb name %p: Caching auth negative entry for Aadb name %p: Caching auth negative entry for AAAAadb name %p: Caching negative entry for A (ttl %u)adb name %p: Caching negative entry for AAAA (ttl %u)adb name %p: caching alias target(type == ((dns_rdatatype_t)dns_rdatatype_a) && !(((adbname)->fetch_a != ((void *)0)))) || (type == ((dns_rdatatype_t)dns_rdatatype_aaaa) && !(((adbname)->fetch_aaaa != ((void *)0))))fetch_name: starting at zone for name %pfindp != ((void *)0) && *findp == ((void *)0)target == ((void *)0) || dns_name_hasbuffer(target)(options & 0x00000003) != 0task != ((void *)0)dns_adb_createfind: returning ISC_R_SHUTTINGDOWNfree_adbfind(adb, &find) == isc_boolean_falsekill_name(&victim, (((4) << 16) + 10), isc_boolean_true) == isc_boolean_falsename->lock_bucket == (-1)(adb->names[bucket]).tail == (adbname)(adb->names[bucket]).head == (adbname)check_expire_namehooks(adbname, now) == isc_boolean_falsedns_adb_createfind: name %p is an alias (cached)dns_adb_createfind: found A for name %p in dbdns_adb_createfind: name %p is an aliasdns_adb_createfind: found AAAA for name %pdns_adb_createfind: started A fetch for name %pdns_adb_createfind: started AAAA fetch for name %pcreatefind: attaching find %p to adbname %p(find->flags & 0x00000003) != 0timermgr != ((void *)0)newadb != ((void *)0) && *newadb == ((void *)0)adbnameadbnamehookadblameinfoadbentryadbfindadbaddrinfoadbfetchisc_mutexblock_destroy((adb->entrylocks), (1009)) == 0isc_mutexblock_destroy((adb->namelocks), (1009)) == 0(*((&adb->overmemlock)) == 0 ? (*((&adb->overmemlock)) = -1, 0) : 34) == 0(*((&adb->reflock)) == 0 ? (*((&adb->reflock)) = -1, 0) : 34) == 0(*((&adb->mplock)) == 0 ? (*((&adb->mplock)) = -1, 0) : 34) == 0(*((&adb->lock)) == 0 ? (*((&adb->lock)) = -1, 0) : 34) == 0ev->ev_type == (((4) << 16) + 1)((name)->fetch_a != ((void *)0)) || ((name)->fetch_aaaa != ((void *)0))adb fetch name %p: caching negative entry for A (ttl %u)adb fetch name %p: caching negative entry for AAAA (ttl %u)adb fetch name %p: caching alias targetadb: fetch of '%s' %s failed: %saddress_type != 0canceledunexpectednot_found"^l4,^^cache.c(((cache) != ((void *)0)) && (((const isc__magic_t *)(cache))->magic == ((('$') << 24 | ('$') << 16 | ('$') << 8 | ('$')))))((*((&cache->lock)))++ == 0 ? 0 : 34) == 0(--(*((&cache->lock))) == 0 ? 0 : 34) == 0cache->db != ((void *)0)((*((&cache->cleaner.lock)))++ == 0 ? 0 : 34) == 0(--(*((&cache->cleaner.lock))) == 0 ? 0 : 34) == 0cache cleaner: dns_db_expirenode() failed: %scould not set cache cleaning interval: %s((*((&cache->filelock)))++ == 0 ? 0 : 34) == 0(--(*((&cache->filelock))) == 0 ? 0 : 34) == 0cache->references == 0(*((&cache->cleaner.lock)) == 0 ? (*((&cache->cleaner.lock)) = -1, 0) : 34) == 0(*((&cache->lock)) == 0 ? (*((&cache->lock)) = -1, 0) : 34) == 0(*((&cache->filelock)) == 0 ? (*((&cache->filelock)) = -1, 0) : 34) == 0cachep != ((void *)0)cache->references > 0error dumping cache: %s isc_task_create() failed: %scachecleanercache cleaner: isc_task_onshutdown() failed: %s*cachep == ((void *)0)((cleaner)->state == cleaner_s_busy && (cleaner)->iterator != ((void *)0) && (cleaner)->resched_event == ((void *)0))end cache cleaning, mem inuse %lucache cleaner could not create iterator: %scache cleaner: dns_dbiterator_first() failed: %sbegin cache cleaning, mem inuse %lutask == cleaner->taskevent->ev_type == (((4) << 16) + 27)cache cleaning timer fired, cleaner state = %devent->ev_type == (((4) << 16) + 15)((*((&cleaner->cache->lock)))++ == 0 ? 0 : 34) == 0(--(*((&cleaner->cache->lock))) == 0 ? 0 : 34) == 0(((cleaner->iterator) != ((void *)0)) && (((const isc__magic_t *)(cleaner->iterator))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('I')))))cache cleaner: dns_dbiterator_current() failed: %scache cleaner: dns_dbiterator_next() failed: %scache cleaner: still overmem, reset and try againcache cleaner: checked %u nodes, mem inuse %lu, sleepingtask == cache->cleaner.taskcache->live_tasks == 0callbacks.ccallbacks != ((void *)0)db.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))*targetp == sourcedbp != ((void *)0)(((*dbp) != ((void *)0)) && (((const isc__magic_t *)(*dbp))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))*dbp == ((void *)0)(((db) != ((void *)0)) && (((const isc__magic_t *)(db))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))(db->attributes & 0x01) == 0addp != ((void *)0) && *addp == ((void *)0)dbloadp != ((void *)0) && *dbloadp == ((void *)0)dbloadp != ((void *)0) && *dbloadp != ((void *)0)*targetp != ((void *)0)versionp != ((void *)0) && *versionp != ((void *)0)*versionp == ((void *)0)nodep != ((void *)0) && *nodep != ((void *)0)sourcep != ((void *)0) && *sourcep != ((void *)0)*sourcep == ((void *)0)(db->attributes & 0x01) != 0iteratorp != ((void *)0) && *iteratorp == ((void *)0)((db->attributes & 0x01) == 0 && version != ((void *)0))|| ((db->attributes & 0x01) != 0 && version == ((void *)0))dns_db_iszone(db) == isc_boolean_trueisc_rwlock_init(&implock, 0, 0) == 0dbimp != ((void *)0) && *dbimp != ((void *)0)isc_rwlock_lock((&implock), (isc_rwlocktype_write)) == 0(implementations).tail == (imp)(implementations).head == (imp)isc_rwlock_unlock((&implock), (isc_rwlocktype_write)) == 0dbimp != ((void *)0) && *dbimp == ((void *)0)(db->attributes & 0x01) == 0 && version != ((void *)0)dns_rdataset_isassociated(rdataset)rdataset->rdclass == db->rdclassnewrdataset == ((void *)0) || ((((newrdataset) != ((void *)0)) && (((const isc__magic_t *)(newrdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(newrdataset))((db->attributes & 0x01) == 0 && version != ((void *)0))|| ((db->attributes & 0x01) != 0 && version == ((void *)0) && (options & 0x01) == 0)(options & 0x04) == 0 || (options & 0x01) != 0addedrdataset == ((void *)0) || ((((addedrdataset) != ((void *)0)) && (((const isc__magic_t *)(addedrdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(addedrdataset))covers == 0 || type == ((dns_rdatatype_t)dns_rdatatype_rrsig)type != ((dns_rdatatype_t)dns_rdatatype_any)sigrdataset == ((void *)0) || ((((sigrdataset) != ((void *)0)) && (((const isc__magic_t *)(sigrdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(sigrdataset))dns_db_iszone(db) || dns_db_isstub(db)rdata.length > 20nodep == ((void *)0) || (nodep != ((void *)0) && *nodep == ((void *)0))dns_name_hasbuffer(foundname)rdataset == ((void *)0) || ((((rdataset) != ((void *)0)) && (((const isc__magic_t *)(rdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(rdataset))dns_name_isabsolute(origin)isc_rwlock_lock((&implock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&implock), (isc_rwlocktype_read)) == 0unsupported database type '%s'dbiterator.citeratorp != ((void *)0)(((*iteratorp) != ((void *)0)) && (((const isc__magic_t *)(*iteratorp))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('I')))))(((iterator) != ((void *)0)) && (((const isc__magic_t *)(iterator))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('I')))))iterator->relative_namesdns_name_hasbuffer(name)name == ((void *)0) || dns_name_hasbuffer(name)dispatch.c((((mgr)) != ((void *)0)) && (((const isc__magic_t *)((mgr)))->magic == ((('D') << 24 | ('M') << 16 | ('g') << 8 | ('r')))))((((disp)) != ((void *)0)) && (((const isc__magic_t *)((disp)))->magic == ((('D') << 24 | ('i') << 16 | ('s') << 8 | ('p')))))dispp != ((void *)0) && *dispp == ((void *)0)((*((&disp->lock)))++ == 0 ? 0 : 34) == 0(--(*((&disp->lock))) == 0 ? 0 : 34) == 0((*((&disp->mgr->buffer_lock)))++ == 0 ? 0 : 34) == 0(--(*((&disp->mgr->buffer_lock))) == 0 ? 0 : 34) == 0(disp->attributes & 0x00000020U) != 0sevent->n <= disp->mgr->buffersizeret < qid->qid_nbucketsbucket < qid->qid_nbucketsdispatch %p: %sdispatchmgr %p: %sqidp != ((void *)0)((((qid)) != ((void *)0)) && (((const isc__magic_t *)((qid)))->magic == ((('Q') << 24 | ('i') << 16 | ('d') << 8 | (' ')))))(*((&qid->lock)) == 0 ? (*((&qid->lock)) = -1, 0) : 34) == 0disp->shutdown_out == 1buf != ((void *)0) && len != 0disp->tcpbuffers > 0disp->mgr->buffers > 0len == disp->mgr->buffersizedispatch %p response %p %s: %sdispatch %p req/resp %p: %s((*((&qid->lock)))++ == 0 ? 0 : 34) == 0cancel: failsafe event %p -> task %p(--(*((&qid->lock))) == 0 ? 0 : 34) == 0disp->recv_pending == 0starttcp %pgot packet: requests %d, buffers %d, recvs %ddisp->recv_pending != 0odd socket result in udp_recv(): %sblackholed packet from %sgot garbage packetgot valid DNS message header, /QR %c, id %usearch for response in bucket %d: %s[a] Sent event %p buffer %p len %d to task %pgot TCP packet: requests %d, buffers %d, recvs %dshutting down on EOFshutting down due to TCP receive error: %s: %sresult %d, length == %d, addr = %p[b] Sent event %p buffer %p len %d to task %pdispp != ((void *)0) && ((((*dispp)) != ((void *)0)) && (((const isc__magic_t *)((*dispp)))->magic == ((('D') << 24 | ('i') << 16 | ('s') << 8 | ('p')))))disp->refcount > 0detach: refcount %d((((*resp)) != ((void *)0)) && (((const isc__magic_t *)((*resp)))->magic == ((('D') << 24 | ('r') << 16 | ('s') << 8 | ('p')))))*sockevent != ((void *)0)disp->requests > 0(qid->qid_table[bucket]).tail == (res)(qid->qid_table[bucket]).head == (res)res->item_out == isc_boolean_truedetaching from task %p(res->items).tail == (ev)(res->items).head == (ev)((*((&mgr->arc4_lock)))++ == 0 ? 0 : 34) == 0(--(*((&mgr->arc4_lock))) == 0 ? 0 : 34) == 0dest != ((void *)0)idp != ((void *)0)attached to task %pbuckets < 2097169increment > bucketsqidp != ((void *)0) && *qidp == ((void *)0)sock != ((void *)0) || sockaddrp != ((void *)0)(*((&disp->lock)) == 0 ? (*((&disp->lock)) = -1, 0) : 34) == 0dispatcherdisp->tcpbuffers == 0disp->requests == 0sockmgr != ((void *)0)localaddr != ((void *)0)buffersize >= 512 && buffersize < (64 * 1024)maxbuffers > 0(attributes & 0x00000002U) == 0((*((&mgr->buffer_lock)))++ == 0 ? 0 : 34) == 0(--(*((&mgr->buffer_lock))) == 0 ? 0 : 34) == 0dispmgr_bpool((*((&mgr->lock)))++ == 0 ? 0 : 34) == 0isc_sockaddr_getport(localaddr) == 0(--(*((&mgr->lock))) == 0 ? 0 : 34) == 0avoid-v%s-udp-ports: unable to allocate a non-blacklisted portudpdispatchcreated UDP dispatcher %pcreated task %pcreated socket %pdestroy_mgr_ok: shuttingdown=%d, listnonempty=%d, epool=%d, rpool=%d, dpool=%d(*((&mgr->lock)) == 0 ? (*((&mgr->lock)) = -1, 0) : 34) == 0(*((&mgr->arc4_lock)) == 0 ? (*((&mgr->arc4_lock)) = -1, 0) : 34) == 0(*((&mgr->pool_lock)) == 0 ? (*((&mgr->pool_lock)) = -1, 0) : 34) == 0(*((&mgr->buffer_lock)) == 0 ? (*((&mgr->buffer_lock)) = -1, 0) : 34) == 0mgrp != ((void *)0)((((*mgrp)) != ((void *)0)) && (((const isc__magic_t *)((*mgrp)))->magic == ((('D') << 24 | ('M') << 16 | ('g') << 8 | ('r')))))destroy: killit=%devent->ev_type == (((4) << 16) + 32)(mgr->list).tail == (disp)(mgr->list).head == (disp)shutting down; detaching from sock %p, task %pisc_socket_gettype(sock) == isc_sockettype_tcp(attributes & 0x00000002U) != 0(attributes & 0x00000004U) == 0tcpdispatchcreated TCP dispatcher %p(((mgr->list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)mgr->stats == ((void *)0)mgrp != ((void *)0) && *mgrp == ((void *)0)dispmgr_epooldispmgr_rpooldispmgr_dpooldlz.c(((view->dlzdatabase) != ((void *)0)) && (((const isc__magic_t *)(view->dlzdatabase))->magic == ((('D') << 24 | ('L') << 16 | ('Z') << 8 | ('D')))))Unloading DLZ driver.dbp != ((void *)0) && (((*dbp) != ((void *)0)) && (((const isc__magic_t *)(*dbp))->magic == ((('D') << 24 | ('L') << 16 | ('Z') << 8 | ('D')))))isc_rwlock_init(&dlz_implock, 0, 0) == 0Unregistering DLZ driver.dlzimp != ((void *)0) && *dlzimp != ((void *)0)isc_rwlock_lock((&dlz_implock), (isc_rwlocktype_write)) == 0(dlz_implementations).tail == (dlz_imp)(dlz_implementations).head == (dlz_imp)isc_rwlock_unlock((&dlz_implock), (isc_rwlocktype_write)) == 0Registering DLZ driver '%s'drivername != ((void *)0)methods->create != ((void *)0)methods->destroy != ((void *)0)methods->findzone != ((void *)0)dlzimp != ((void *)0) && *dlzimp == ((void *)0)DLZ Driver '%s' already registereddlzname != ((void *)0)Loading '%s' using driver %sisc_rwlock_lock((&dlz_implock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&dlz_implock), (isc_rwlocktype_read)) == 0unsupported DLZ database driver '%s'. %s not loaded.DLZ driver loaded successfully.DLZ driver failed to load.dnssec.cmsg->query.base != ((void *)0)r.length >= 19dns_name_downcase(&sig->signer, (&((&fname)->name)), ((void *)0)) == 0sigrdata != ((void *)0) && sigrdata->type == ((dns_rdatatype_t)dns_rdatatype_rrsig)dns_name_downcase(name, (&((&fnewname)->name)), ((void *)0)) == 0rdatas[i].length < 65536dns_name_concatenate(dns_wildcardname, (&((&fnewname)->name)), wild, ((void *)0)) == 0dns_name_countlabels(name) <= 255inception != ((void *)0)expire != ((void *)0)sigrdata != ((void *)0)*key == ((void *)0)rdata->type == ((dns_rdatatype_t)dns_rdatatype_key) || rdata->type == ((dns_rdatatype_t)dns_rdatatype_dnskey)nkeys != ((void *)0)keys != ((void *)0)ds.ckey->type == ((dns_rdatatype_t)dns_rdatatype_dnskey)r.length >= 4forward.c(forwarders->addrs).tail == (sa)(forwarders->addrs).head == (sa)fwdtablep != ((void *)0) && (((*fwdtablep) != ((void *)0)) && (((const isc__magic_t *)(*fwdtablep))->magic == ((('F') << 24 | ('w') << 16 | ('d') << 8 | ('T')))))(((fwdtable) != ((void *)0)) && (((const isc__magic_t *)(fwdtable))->magic == ((('F') << 24 | ('w') << 16 | ('d') << 8 | ('T')))))isc_rwlock_lock((&fwdtable->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&fwdtable->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_lock((&fwdtable->rwlock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&fwdtable->rwlock), (isc_rwlocktype_write)) == 0fwdtablep != ((void *)0) && *fwdtablep == ((void *)0)iptable.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('T') << 24 | ('a') << 16 | ('b') << 8 | ('l')))))(((tab) != ((void *)0)) && (((const isc__magic_t *)(tab))->magic == ((('T') << 24 | ('a') << 16 | ('b') << 8 | ('l')))))(&tab->refcount)->refs > 0(((dtab) != ((void *)0)) && (((const isc__magic_t *)(dtab))->magic == ((('T') << 24 | ('a') << 16 | ('b') << 8 | ('l')))))(&dtab->refcount)->refs == 0tab->radixjournal.ci < j->header.index_size! ((j->index[i]).offset != 0)j->it.result == 0%s: write: %s%s: read: %s%s: seek: %sp == j->rawindex + rawbytes(((j) != ((void *)0)) && (((const isc__magic_t *)(j))->magic == ((('J') << 24 | ('O') << 16 | ('U') << 8 | ('R')))))j->state == JOURNAL_STATE_WRITE%s: journal file corrupt: expected serial %u, got %u%s: offset too largej->it.bpos.serial == begin_serialj->it.epos.serial == end_serialjournalp != ((void *)0) && *journalp == ((void *)0)rbrb+journal file %s does not exist, creating itwb%s: create: %s%s: close: %s%s: open: %s%s: journal format not recognized%.*s.jbk%s: flush: %s%s: fsync: %sj->state == JOURNAL_STATE_TRANSACTION%s: malformed transaction: %d SOAs%s: malformed transaction: serial number would decreasemalformed transaction: %s last serial %u != transaction first serial %uj->offset <= j->it.epos.offset%s: journal corrupt: empty transaction%s: journal corrupt: impossible RR size (%d bytes)%.*s.jnwbest_guess.serial != j->header.end.serialno journal file, but that's OK%s: journal file corrupt: missing initial SOA%s: applying diff to database (%u)%s: applying final diff to database (%u)(((diff) != ((void *)0)) && (((const isc__magic_t *)(diff))->magic == ((('D') << 24 | ('I') << 16 | ('F') << 8 | ('F')))))writing to journalt->rdata.length < 65536((&buffer)->length - (&buffer)->used) >= t->rdata.lengthused.length == size(((diff[0].tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((diff[1].tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((diff[i].tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(diff[i].tuples).tail == (p[i])(diff[i].tuples).head == (p[i])(diff[0].tuples).tail == (p[0])(diff[0].tuples).head == (p[0])(diff[1].tuples).tail == (p[1])(diff[1].tuples).head == (p[1])no changesmissing SOAno journal filejournal open failure: %s: %s%s: cannot print: journal file corruptkeytable.c(((keynode) != ((void *)0)) && (((const isc__magic_t *)(keynode))->magic == ((('K') << 24 | ('N') << 16 | ('o') << 8 | ('d')))))(((keytable) != ((void *)0)) && (((const isc__magic_t *)(keytable))->magic == ((('K') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))keynodep != ((void *)0) && (((*keynodep) != ((void *)0)) && (((const isc__magic_t *)(*keynodep))->magic == ((('K') << 24 | ('N') << 16 | ('o') << 8 | ('d')))))((*((&keytable->lock)))++ == 0 ? 0 : 34) == 0keytable->active_nodes > 0(--(*((&keytable->lock))) == 0 ? 0 : 34) == 0wantdnssecp != ((void *)0)isc_rwlock_lock((&keytable->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&keytable->rwlock), (isc_rwlocktype_read)) == 0foundname != ((void *)0)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('K') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))nextnodep != ((void *)0) && *nextnodep == ((void *)0)keynodep != ((void *)0) && *keynodep == ((void *)0)isc_rwlock_lock((&keytable->rwlock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&keytable->rwlock), (isc_rwlocktype_write)) == 0keytablep != ((void *)0) && (((*keytablep) != ((void *)0)) && (((const isc__magic_t *)(*keytablep))->magic == ((('K') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))keytable->references > 0(*((&keytable->lock)) == 0 ? (*((&keytable->lock)) = -1, 0) : 34) == 0keytablep != ((void *)0) && *keytablep == ((void *)0)libdns.catlog.clctx != ((void *)0)notifysecurity_placeholderdnssecxfer-inxfer-outlame-serversdelegation-onlyedns-disableddns/dbdns/rbtdbdns/rbtdb64dns/rbtdns/rdatadns/masterdns/messagedns/cachedns/configdns/resolverdns/zonedns/journaldns/adbdns/xfrindns/xfroutdns/acldns/validatordns/dispatchdns/requestdns/masterdumpdns/tsigdns/tkeydns/sdbdns/diffdns/hintsdns/acachedns/dlz%s: %s:%lu: $TTL %lu > MAXTTL, setting $TTL to 0dns_master_loadmaster.c(((lctx) != ((void *)0)) && (((const isc__magic_t *)(lctx))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))((*((&lctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&lctx->lock))) == 0 ? 0 : 34) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))(this->rdata).tail == (rdata)(this->rdata).head == (rdata)(save).tail == (rdata)rdcount == old_lenmaster_file != ((void *)0)new_in_use < 4lctxp != ((void *)0) && *lctxp == ((void *)0)callbacks->add != ((void *)0)dns_name_isabsolute(top)(task == ((void *)0) && done == ((void *)0)) || (task != ((void *)0) && done != ((void *)0))((buffer)->length - (buffer)->used) >= lendns_rdatalist_tordataset(this, &dataset) == 0dns_master_load: %s%s: %s:%lu: %s: %s%s: %s: %s(*head).tail == (this)(*head).head == (this)isc_stdio_read failed: %sdns_master_load: file format mismatchdns_master_load: unsupported file format version((&target)->length - (&target)->used) >= sizeof(totallen)((&target)->current) <= readleni > 0(rdatalist.rdata).tail == (&rdata[j])(rdatalist.rdata).head == (&rdata[j])(rdatalist.rdata).tail == (&rdata[i])(rdatalist.rdata).head == (&rdata[i])lctx->done != ((void *)0) && lctx->task != ((void *)0)isc_stdio_open() failed: %s{%d,%u,%1[doxX]}%%0%ud%%0%u%cdns_master_load: %s:%lu: isc_lex_gettoken() failed: %slinedns_master_load: %s:%lu: unexpected end of %s%s: file does not end with newlineisc_lex_close(lctx->lex) == 0$ORIGIN$TTL$INCLUDE%s: %s:%lu: $INCLUDE not allowed%s: %s:%lu: $INCLUDE may not be used with $DATE$DATE%s: %s:%lu: $DATE outside epoch%s: %s:%lu: $DATE in future, using current date$GENERATE%s: %s:%lu: no TTL specified%u-%u/%u%s: %s:%lu: invalid range '%s'%s: %s:%lu: unknown RR type '%s'%s: %s:%lu: unsupported type '%s'%s:%lu: ignoring out-of-zone data (%s)(rdatalist.rdata).tail == (&rdata)(rdatalist.rdata).head == (&rdata)$GENERATE: %s$GENERATE: %s:%lu: %s$%s: %s:%lu: unknown $ directive '%s'%s:%lu: warning: ownername '%s' contains an non-terminal wildcard%s:%lu: isc_lex_gettoken() returned unexpected token type (%d)%s:%lu: no current owner nameisc_lex_gettoken() returned unexpected token type%s:%lu: unknown RR type '%.*s'%s:%lu: class '%s' != zone class '%s'%s:%lu: %s '%s': %s%s:%lu: SOA record not at top of zone (%s)%s:%lu: no TTL specified; using SOA MINTTL instead%s:%lu: no TTL specified; zone rejected%s:%lu: using RFC1035 TTL semantics%s:%lu: signature has expired%s:%lu: old style DNSSEC zone detected(*current).tail == (this)(*current).head == (this)(save).tail == (this)(*glue).tail == (this)(*glue).head == (this)rdlcount == old_len%s:%lu: TTL set to prior TTL (%lu)(current_list).tail == (this)(current_list).head == (this)(glue_list).tail == (this)(glue_list).head == (this)%s:%lu: NS record '%s' appears to be an addresslctxp != ((void *)0)lctx->references > 0isc_stdio_close() failed: %s(*((&lctx->lock)) == 0 ? (*((&lctx->lock)) = -1, 0) : 34) == 0lex != ((void *)0)done != ((void *)0)result != (((1) << 16) + 28)stream != ((void *)0)nSNDx  nSND   nSND   masterdump.c(((dctx) != ((void *)0)) && (((const isc__magic_t *)(dctx))->magic == ((('D') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))stylep != ((void *)0) && *stylep != ((void *)0)stylep != ((void *)0) && *stylep == ((void *)0)nspaces >= 0style->tab_width != 0((*((&dctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&dctx->lock))) == 0 ? 0 : 34) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))could not set master file stylelength <= sizeof(ttlbuf)\-;-$NXDOMAIN ;-$NXRRSET itresult == 0$ORIGIN %.*s n <= 64trust < (sizeof(trustnames) / sizeof(trustnames[0])); %s buffer->length > 0$TTL %u ; %.*s $TTL %u dumping node to file: %s: open: %sdumping master file: %s: close: %sdumping master file: %s: open: %sr_hdr.length >= sizeof(dns_masterrawrdataset_t)totallen <= sizeof(dns_masterrawrdataset_t)((buffer)->length - (buffer)->used) >= (sizeof(dlen) + r.length)r.length <= 0xffffU((buffer)->used) < totallenraw master file write failed: %s$DATE %.*s ((&buffer)->used) <= sizeof(rawheader)dumptostreaminc(%p) new nodes -> %d dumping master file: %s: fsync: %sdumping master file: %s: fclose: %sdumping master file: rename: %s: %sdctxp != ((void *)0)dctx->references != 0(*((&dctx->lock)) == 0 ? (*((&dctx->lock)) = -1, 0) : 34) == 0additionalauthauthorityauthanswerlocal? P...@x5 (P (P (P (0PVȶд̴شncache.cncacherdataset != ((void *)0)ncacherdataset->type == 0dns_rdataset_next(ncacherdataset) == 29remaining.length >= tname.lengthremaining.length >= 4remaining.length >= 2remaining.length >= lengthraw != ((void *)0)rdataset->type == 0dns_rdataset_next(rdataset) == 29remaining.length >= name.lengthremaining.length >= rdata.lengthmessage != ((void *)0)count <= 65535r.length <= 65535dns_rdatalist_tordataset(&ncrdatalist, &ncrdataset) == 0nsec.cnsec != ((void *)0)nsec->type == ((dns_rdatatype_t)dns_rdatatype_nsec)i + 2 <= nsecstruct.leni + len <= nsecstruct.lenr.length <= (255 + 8192 + 512)order.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('O') << 24 | ('r') << 16 | ('d') << 8 | ('r')))))(((order) != ((void *)0)) && (((const isc__magic_t *)(order))->magic == ((('O') << 24 | ('r') << 16 | ('d') << 8 | ('r')))))(&order->references)->refs > 0(order->ents).tail == (ent)(order->ents).head == (ent)(&order->references)->refs == 0mode == 0x00000800 || mode == 0x00000400 || mode == 0dns_name_copy(name, (&((&ent->name)->name)), ((void *)0)) == 0orderp != ((void *)0) && *orderp == ((void *)0)peer.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('s') << 24 | ('e') << 16 | ('R') << 8 | ('L')))))*target == ((void *)0)source->refs != 0xffffffffU(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('S') << 24 | ('E') << 16 | ('r') << 8 | ('v')))))(((peer) != ((void *)0)) && (((const isc__magic_t *)(peer))->magic == ((('S') << 24 | ('E') << 16 | ('r') << 8 | ('v')))))retval != ((void *)0)transfer_source != ((void *)0)notify_source != ((void *)0)query_source != ((void *)0)udpsize != ((void *)0)maxudp != ((void *)0)peer != ((void *)0)*peer != ((void *)0)(((*peer) != ((void *)0)) && (((const isc__magic_t *)(*peer))->magic == ((('S') << 24 | ('E') << 16 | ('r') << 8 | ('v')))))p->refs > 0p->refs == 0*list != ((void *)0)(((*list) != ((void *)0)) && (((const isc__magic_t *)(*list))->magic == ((('s') << 24 | ('e') << 16 | ('R') << 8 | ('L')))))plist->refs > 0l->refs == 0(l->elements).tail == (server)(l->elements).head == (server)peerptr != ((void *)0)(((servers) != ((void *)0)) && (((const isc__magic_t *)(servers))->magic == ((('s') << 24 | ('e') << 16 | ('R') << 8 | ('L')))))portlist.cxtry <= maxxtry >= min(((portlist) != ((void *)0)) && (((const isc__magic_t *)(portlist))->magic == ((('P') << 24 | ('L') << 16 | ('S') << 8 | ('T')))))portlistp != ((void *)0) && *portlistp == ((void *)0)(&portlist->refcount)->refs > 0af == 2 || af == 10((*((&portlist->lock)))++ == 0 ? 0 : 34) == 0(--(*((&portlist->lock))) == 0 ? 0 : 34) == 0portlistp != ((void *)0)(&portlist->refcount)->refs == 0(*((&portlist->lock)) == 0 ? (*((&portlist->lock)) = -1, 0) : 34) == 0rbt.c(((rbt) != ((void *)0)) && (((const isc__magic_t *)(rbt))->magic == ((('R') << 24 | ('B') << 16 | ('T') << 8 | ('+')))))name->offsets == ((void *)0)((bucket_node)->hashnext) != ((void *)0)rootp != ((void *)0)child != ((void *)0)(((chain) != ((void *)0)) && (((const isc__magic_t *)(chain))->magic == ((('0') << 24 | ('-') << 16 | ('0') << 8 | ('-')))))(((chain) != ((void *)0)) && (((const isc__magic_t *)(chain))->magic == ((('0') << 24 | ('-') << 16 | ('0') << 8 | ('-'))))) && chain->end != ((void *)0)chain->level_count > 0 && (((current)->is_root == 1) ? isc_boolean_true : isc_boolean_false)chain != ((void *)0)REDblack (%s from (BAD parent pointer! -> ++ BEG down from -- END down from ** Red/Red color violation on left** Red/Red color violation on rightprintname != ((void *)0)rbtp != ((void *)0) && (((*rbtp) != ((void *)0)) && (((const isc__magic_t *)(*rbtp))->magic == ((('R') << 24 | ('B') << 16 | ('T') << 8 | ('+')))))rbt->nodecount == 0dns_rbt_destroy2(rbtp, 0) == 0dns_rbt_deletetree(rbt, ((node)->down)) == 0((((delete)->is_root == 1) ? isc_boolean_true : isc_boolean_false) && *rootp == delete) || (! (((delete)->is_root == 1) ? isc_boolean_true : isc_boolean_false) && (((((delete)->parent))->left) == delete || ((((delete)->parent))->right) == delete))! (((delete)->is_root == 1) ? isc_boolean_true : isc_boolean_false)child == ((void *)0) || ! (((child)->is_root == 1) ? isc_boolean_true : isc_boolean_false)(node)->references == 0node != ((void *)0) && *node == ((void *)0)(options & (0x02 | 0x04)) != (0x02 | 0x04)current == current_rootcompared == dns_namereln_commonancestor || compared == dns_namereln_containschain->level_matches > 0((options & 0x02) != 0) || ((options & 0x01) == 0 && ((current)->data) == ((void *)0))chain->level_count > 0chain->level_matches < chain->level_countorder < 0data != ((void *)0) && *data == ((void *)0)name->offsets != ((void *)0)(((*root)->is_root == 1) ? isc_boolean_true : isc_boolean_false)*root == ((void *)0) || ((((*root)->is_root == 1) ? isc_boolean_true : isc_boolean_false) && ((*root)->parent) == current)isc_boolean_true && ((node)->left) == ((void *)0) && ((node)->right) == ((void *)0)((current)->left) == ((void *)0)((current)->right) == ((void *)0)((node)->parent) == ((void *)0)(((root)->is_root == 1) ? isc_boolean_true : isc_boolean_false)rbtp != ((void *)0) && *rbtp == ((void *)0)deleter == ((void *)0) ? deleter_arg == ((void *)0) : 1rbtdb.c((rbtdb) != ((void *)0) && (rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('4')))(&rbtdb->references)->refs > 0(&rbtversion->references)->refs > 0refs > 1lockrefs != 0noderefs != 0(((rbtdb)->common.attributes & 0x01) != 0)((void *)((header)->lru_link.prev) != (void *)(-1))(rbtdb->rdatasets[header->node->locknum]).tail == (header)(rbtdb->rdatasets[header->node->locknum]).head == (header)rbtdbiter->tree_locked != isc_rwlocktype_none((*((&rbtdb->node_locks[node->locknum].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[node->locknum].lock))) == 0 ? 0 : 34) == 0header != ((void *)0)((*((&rbtdb->node_locks[rbtnode->locknum].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[rbtnode->locknum].lock))) == 0 ? 0 : 34) == 0((*((&rbtdb->node_locks[onode->locknum].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[onode->locknum].lock))) == 0 ? 0 : 34) == 0!(((rbtdb)->common.attributes & 0x01) != 0)(node)->references > 0((*((&rbtdb->lock)))++ == 0 ? 0 : 34) == 0version->writer(--(*((&rbtdb->lock))) == 0 ? 0 : 34) == 0(&version->references)->refs > 0array[i].entry == ((void *)0) && array[i].cbarg == ((void *)0)rbtdb->future_version == ((void *)0)rbtdb->next_serial != 0cbargp != ((void *)0) && *cbargp != ((void *)0)total_count > current_count((*((nodelock)))++ == 0 ? 0 : 34) == 0(--(*((nodelock))) == 0 ? 0 : 34) == 0arg != ((void *)0)acarray[count].cbarg == cbargacarray[count].cbarg != ((void *)0)zone_findzonecut() called!rbtdbiter->pausedrbtdbiter->tree_locked == isc_rwlocktype_noneisc_rwlock_lock((&rbtdb->tree_lock), (isc_rwlocktype_read)) == 0((*((&(search->rbtdb->node_locks[node->locknum].lock))))++ == 0 ? 0 : 34) == 0(--(*((&(search->rbtdb->node_locks[node->locknum].lock)))) == 0 ? 0 : 34) == 0dns_name_copy(name, zcname, ((void *)0)) == 0isc_rwlock_unlock((&rbtdb->tree_lock), (isc_rwlocktype_read)) == 0n >= 2((*((&(rbtdb->node_locks[node->locknum].lock))))++ == 0 ? 0 : 34) == 0(--(*((&(rbtdb->node_locks[node->locknum].lock)))) == 0 ? 0 : 34) == 0(rbtdb->deadnodes[bucketnum]).tail == (node)(rbtdb->deadnodes[bucketnum]).head == (node)((node)->references) == 0 && node->data == ((void *)0)cleanup_dead_nodes: dns_rbt_deletenode: %s(rbtdb->rdatasets[idx]).tail == (rdataset)(rbtdb->rdatasets[idx]).head == (rdataset)((*((lock)))++ == 0 ? 0 : 34) == 0(--(*((lock))) == 0 ? 0 : 34) == 0search->zonecut == ((void *)0)(int)nrefs >= 0(&nodelock->references)->refs > 0(int)refs >= 0least_serial != 0dcurrent->serial <= dparent->serialdcurrent->serial <= least_serialresult == 0 || result == 17decrement_reference: delete from rbt: %p %sdecrement_reference: dns_rbt_deletenode: %s!((void *)((node)->deadlink.prev) != (void *)(-1))isc_rwlock_unlock((&rbtdb->tree_lock), (isc_rwlocktype_write)) == 0rbtdbiter->node != ((void *)0)flush_deletions: %d nodes of %d in treeisc_rwlock_lock((&rbtdb->tree_lock), (isc_rwlocktype_write)) == 0rbtdbiter->tree_locked == isc_rwlocktype_readrbtversion != ((void *)0)rbtversion->serial >= header->serialrbtversion == ((void *)0) || rbtversion->serial >= topheader->serial!loadingdbloadp != ((void *)0)loadctx->rbtdb == rbtdb(rbtdb->attributes & 0x02) != 0(rbtdb->attributes & 0x01) == 0!version->writerversion->commit_okversion == rbtdb->future_version(&cur_version->references)->refs > 0(((cur_version->changed_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(rbtdb->open_versions).tail == (cur_version)(rbtdb->open_versions).head == (cur_version)(version->changed_list).tail == (changed)(version->changed_list).head == (changed)cur_ref == 1version->serial < least_greater->serial(((version->changed_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(rbtdb->open_versions).tail == (version)(rbtdb->open_versions).head == (version)(((cleanup_version->changed_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)((search.rbtdb) != ((void *)0) && (search.rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('4')))isc_rwlock_lock((&search.rbtdb->tree_lock), (isc_rwlocktype_read)) == 0((*((&(search.rbtdb->node_locks[node->locknum].lock))))++ == 0 ? 0 : 34) == 0(--(*((&(search.rbtdb->node_locks[node->locknum].lock)))) == 0 ? 0 : 34) == 0isc_rwlock_unlock((&search.rbtdb->tree_lock), (isc_rwlocktype_read)) == 0rbtversion->serial >= topheader->serial(rbtdb->attributes & (0x01|0x02)) == 0(rbtnode)->references > 0result == 23node %p, %u references, locknum = %u type %u serial = %lu, ttl = %u, trust = %u, attributes = %u (empty) FORCEcheckovermem cache: %s %sovermem cache: stale %sovermem cache: reprieve by RETAIN() %sovermem cache: saved %srbtdbiter->result == 0isc_rwlock_lock((&rbtdb->tree_lock), (locktype)) == 0isc_rwlock_unlock((&rbtdb->tree_lock), (locktype)) == 0(rbtdb->deadnodes[node->locknum]).tail == (node)(rbtdb->deadnodes[node->locknum]).head == (node)rbtdb->current_version != ((void *)0) || (((rbtdb->open_versions).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(&rbtdb->current_version->references)->refs > 0(rbtdb->open_versions).tail == (rbtdb->current_version)(rbtdb->open_versions).head == (rbtdb->current_version)(&rbtdb->current_version->references)->refs == 0(rbtdb->deadnodes[i]).tail == (node)(rbtdb->deadnodes[i]).head == (node)rbtdb->task != ((void *)0)adjust_quantum -> %dresult == 0 && rbtdb->tree == ((void *)0)done free_rbtdb(%s)(&rbtdb->node_locks[i].references)->refs == 0(*((&rbtdb->node_locks[i].lock)) == 0 ? (*((&rbtdb->node_locks[i].lock)) = -1, 0) : 34) == 0(((rbtdb->rdatasets[i]).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((rbtdb->deadnodes[i]).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(&rbtdb->references)->refs == 0(*((&rbtdb->lock)) == 0 ? (*((&rbtdb->lock)) = -1, 0) : 34) == 0rbtdb->node_lock_count < (1 << 10)(&rbtdb->node_locks[i].references)->refs > 0result != 18targetp != ((void *)0) && *targetp != ((void *)0)((*((&nodelock->lock)))++ == 0 ? 0 : 34) == 0(--(*((&nodelock->lock))) == 0 ? 0 : 34) == 0calling free_rbtdb(%s)((*((&rbtdb->node_locks[i].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[i].lock))) == 0 ? 0 : 34) == 0!search.need_cleanupversion == ((void *)0)victim->node->locknum == rbtnode->locknumrbtnode != victim->node((rbtdb) != ((void *)0) && (rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('8')))((search.rbtdb) != ((void *)0) && (search.rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('8')))rdatasetiter.c(((*iteratorp) != ((void *)0)) && (((const isc__magic_t *)(*iteratorp))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('i')))))(((iterator) != ((void *)0)) && (((const isc__magic_t *)(iterator))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('i')))))rdataslab.cslab != ((void *)0)tslabp != ((void *)0) && *tslabp == ((void *)0)mslab != ((void *)0) && sslab != ((void *)0)mcount > 0 && scount > 0tcurrent == tstart + tlengthoslab != ((void *)0) && nslab != ((void *)0)ocount > 0 && ncount > 0ocount != 0request.c(((request) != ((void *)0)) && (((const isc__magic_t *)(request))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('!')))))mgr_gethash(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('M')))))dns_requestmgr_attach: %p: eref %d iref %dmgr_destroyrequestmgr->eref == 0requestmgr->iref == 0(*((&requestmgr->lock)) == 0 ? (*((&requestmgr->lock)) = -1, 0) : 34) == 0(*((&requestmgr->locks[i])) == 0 ? (*((&requestmgr->locks[i])) = -1, 0) : 34) == 0requestmgrp != ((void *)0)(((requestmgr) != ((void *)0)) && (((const isc__magic_t *)(requestmgr))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('M')))))((*((&requestmgr->lock)))++ == 0 ? 0 : 34) == 0requestmgr->eref > 0dns_requestmgr_detach: %p: eref %d iref %drequestmgr->exiting && ((requestmgr->requests).head) == ((void *)0)(--(*((&requestmgr->lock))) == 0 ? 0 : 34) == 0req_sendevent: request %psend_shutdown_events: %p(requestmgr->whenshutdown).tail == (event)(requestmgr->whenshutdown).head == (event)req_destroy: request %prequestmgr->iref > 0((requestmgr->requests).head) == ((void *)0)requestp != ((void *)0) && (((*requestp) != ((void *)0)) && (((const isc__magic_t *)(*requestp))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('!')))))dns_request_destroy: request %p((*((&request->requestmgr->lock)))++ == 0 ? 0 : 34) == 0((*((&request->requestmgr->locks[request->hash])))++ == 0 ? 0 : 34) == 0(request->requestmgr->requests).tail == (request)(request->requestmgr->requests).head == (request)!(((request)->flags & 0x0001) != 0)!(((request)->flags & 0x0002) != 0)(--(*((&request->requestmgr->locks[request->hash]))) == 0 ? 0 : 34) == 0(--(*((&request->requestmgr->lock))) == 0 ? 0 : 34) == 0!((void *)((request)->link.prev) != (void *)(-1))request->dispentry == ((void *)0)request->dispatch == ((void *)0)request->timer == ((void *)0)request->answer != ((void *)0)dns_request_getresponse: request %pdns_request_cancel: request %pdns_requestmgr_shutdown: %p(((requestmgr->requests).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)dns_requestmgr_whenshutdownblackholed address %sreq_cancel: request %p(((request)->flags & 0x0002) != 0)req_senddone: request %pevent->ev_type == (((4) << 16) + 33)req_response: request %p: %sreq_send: request %preq_timeout: request %pdestaddr != ((void *)0)requestp != ((void *)0) && *requestp == ((void *)0)timeout > 0isc_sockaddr_pf(srcaddr) == isc_sockaddr_pf(destaddr)dns_request_createviasocket != ((void *)0)bufferp != ((void *)0) && *bufferp == ((void *)0)request_renderdns_request_createvia: request %p(requestmgr->requests).tail == (request)(requestmgr->requests).head == (request)dns_request_createvia: failed %smsgbuf != ((void *)0)dns_request_createrawdns_request_createraw: request %pdns_request_createraw: failed %s(((request)->flags & 0x0001) != 0)req_connected: request %pdns_requestmgr_createrequestmgrp != ((void *)0) && *requestmgrp == ((void *)0)socketmgr != ((void *)0)isc_socket_gettype(socket) == isc_sockettype_udpdns_requestmgr_create: %psoa.crdata->type == ((dns_rdatatype_t)dns_rdatatype_soa)rdata->length >= 20offset >= 0 && offset <= 16ssu.c(((rule) != ((void *)0)) && (((const isc__magic_t *)(rule))->magic == ((('S') << 24 | ('S') << 16 | ('U') << 8 | ('R')))))types != ((void *)0) && *types != ((void *)0)(((table) != ((void *)0)) && (((const isc__magic_t *)(table))->magic == ((('S') << 24 | ('S') << 16 | ('U') << 8 | ('T')))))rule != ((void *)0) && *rule == ((void *)0)nextrule != ((void *)0) && *nextrule == ((void *)0)signer == ((void *)0) || dns_name_isabsolute(signer)dns_name_isabsolute(identity)matchtype <= 9dns_name_iswildcard(name)types != ((void *)0)tablep != ((void *)0) && *tablep == ((void *)0)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('S') << 24 | ('S') << 16 | ('U') << 8 | ('T')))))tablep != ((void *)0)((*((&table->lock)))++ == 0 ? 0 : 34) == 0table->references > 0(--(*((&table->lock))) == 0 ? 0 : 34) == 0(table->rules).tail == (rule)(table->rules).head == (rule)(*((&table->lock)) == 0 ? (*((&table->lock)) = -1, 0) : 34) == 0tcpmsg.csock != ((void *)0)tcpmsg != ((void *)0)(((tcpmsg) != ((void *)0)) && (((const isc__magic_t *)(tcpmsg))->magic == ((('T') << 24 | ('C') << 16 | ('P') << 8 | ('m')))))maxsize < 65536tcpmsg->task == ((void *)0)xfrin.ctransfer of '%s' from %s: %s(((xfr) != ((void *)0)) && (((const isc__magic_t *)(xfr))->magic == ((('X') << 24 | ('f') << 16 | ('r') << 8 | ('I')))))Transfer completed: %d messages, %d records, %llu bytes, %u.%03u secs (%u bytes/sec)xfr->refcount > 0shut downgiving upfailed setting up socketxfrp != ((void *)0) && *xfrp == ((void *)0)isc_sockaddr_pf(masteraddr) == isc_sockaddr_pf(sourceaddr)zone transfer setup failedsent request length prefixfailed sending request length prefixrequesting IXFR for serial %u(rdl->rdata).tail == (rdata)(rdl->rdata).head == (rdata)region.length <= 65535connected using %sfailed to connectsent request datafailed sending request dataev->ev_type == (((4) << 16) + 7)received %u bytesgot %s, retrying with AXFRresettingempty answer section, retrying with AXFRTSIG check failed: %snon-SOA response to SOA queryrequested serial %u, master has %u, not updatingfirst RR in zone transfer must be SOAgot incremental responsegot incremental response to AXFR requestxfr->db != ((void *)0)got nonincremental responseIXFR out of sync: expected serial %u, got %ufailed while receiving responseszonekey.ckeyrdata != ((void *)0)libdst.cat%s dst_parse.cpriv != ((void *)0)%s v%d.%d Private-key-format:%s %d Algorithm:(RSA) (DH) (DSA) (RSASHA1) (HMAC_MD5) (HMAC_SHA1) (HMAC_SHA224) (HMAC_SHA256) (HMAC_SHA384) (HMAC_SHA512) (?) v%d.%dModulus:PublicExponent:PrivateExponent:Prime1:Prime2:Exponent1:Exponent2:Coefficient:Prime(p):Generator(g):Private_value(x):Public_value(y):Subprime(q):Base(g):Key:Bits:T`p !"#01234  $  $ ! $0 1 $@ A $P Q $GSSAPI error: Major = %u, Minor = %u.diff.c(((t) != ((void *)0)) && (((const isc__magic_t *)(t))->magic == ((('D') << 24 | ('I') << 16 | ('F') << 8 | ('T')))))diff_tuple_tordataset failed: %sbuf.used >= 1 && ((char *) buf.base)[buf.used-1] == '\n'adddel%s %.*s %s %.*s(diff->tuples).tail == (p)(diff->tuples).head == (p)((diff->tuples).head) == ((void *)0)op == DNS_DIFFOP_ADDupdate with no effect'%s/%s/%s': TTL differs in rdataset, adjusting %lu -> %lu(((*tuplep) != ((void *)0)) && (((const isc__magic_t *)(*tuplep))->magic == ((('D') << 24 | ('I') << 16 | ('F') << 8 | ('T')))))(diff->tuples).tail == (ot)(diff->tuples).head == (ot)unexpected non-minimal diff(diff->tuples).tail == (t)(diff->tuples).head == (t)(((diff->tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)tp != ((void *)0) && *tp == ((void *)0)datap == (unsigned char *)t + sizegetaddresses.chostname != ((void *)0)addrs != ((void *)0)addrcount != ((void *)0)addrsize > 0%u.%u.%u.%u<INVARIANTREQUIREENSUREINSIST%s:%d: %s(%s) %s. base64.cABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=buffer.c(((b) != ((void *)0)) && (((const isc__magic_t *)(b))->magic == (0x42756621U)))!((void *)((b)->link.prev) != (void *)(-1))b->mctx == ((void *)0)b->used + n <= b->lengthb->used >= nb->current + n <= b->usedn <= b->currentb->used - b->current >= 1b->used + 1 <= b->lengthb->used - b->current >= 2b->used + 2 <= b->lengthb->used - b->current >= 4b->used + 4 <= b->lengthb->used - b->current >= 6b->used + 6 <= b->lengthdynbuffer != ((void *)0)(((*dynbuffer) != ((void *)0)) && (((const isc__magic_t *)(*dynbuffer))->magic == (0x42756621U)))(*dynbuffer)->mctx != ((void *)0)*dynbuffer == ((void *)0)b->used + length <= b->lengthl <= ((b)->length - (b)->used)b->length <= lengthbase != ((void *)0)RUNTIME_CHECK(%s) %sfatal error%s:%d: %s: %s:%d: event.csize >= sizeof(struct isc_event)hash.c((((hctx)) != ((void *)0)) && (((const isc__magic_t *)((hctx)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))hctxp != ((void *)0) && *hctxp == ((void *)0)(&hctx->refcnt)->refs > 0hctxp != ((void *)0) && *hctxp != ((void *)0)((*((&hctx->lock)))++ == 0 ? 0 : 34) == 0(&hctx->refcnt)->refs == 0(--(*((&hctx->lock))) == 0 ? 0 : 34) == 0(*((&hctx->lock)) == 0 ? (*((&hctx->lock)) = -1, 0) : 34) == 0hash != ((void *)0) && ((((hash)) != ((void *)0)) && (((const isc__magic_t *)((hash)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))(&hash->refcnt)->refs > 0hctxp != ((void *)0) && ((((*hctxp)) != ((void *)0)) && (((const isc__magic_t *)((*hctxp)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))p == (unsigned char *)hctx->rndvector + hctx->vectorlenkeylen <= hash->limithctx != ((void *)0) && ((((hctx)) != ((void *)0)) && (((const isc__magic_t *)((hctx)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))keylen <= hctx->limithash == ((void *)0)((*((&createlock)))++ == 0 ? 0 : 34) == 0(--(*((&createlock))) == 0 ? 0 : 34) == 0  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~heap.c((i) == 1 || ! heap->compare(heap->array[(i)], heap->array[((i) >> 1)]))(((heap) != ((void *)0)) && (((const isc__magic_t *)(heap))->magic == ((('H') << 24 | ('E') << 16 | ('A') << 8 | ('P')))))index >= 1 && index <= heap->lastindex >= 1heapp != ((void *)0) && *heapp == ((void *)0)compare != ((void *)0)heapp != ((void *)0)hex.c0123456789ABCDEFhmacmd5.clen <= 16Uhmacsha.clen <= 64Ulen <= 48Ulen <= 32Ulen <= 28Ulen <= 20Ulex.c(((lex) != ((void *)0)) && (((const isc__magic_t *)(lex))->magic == ((('L') << 24 | ('e') << 16 | ('x') << 8 | ('!')))))source->pushback->current > 0tokenp != ((void *)0)((source->pushback)->current) != 0 || tokenp->type == isc_tokentype_eofsource->ignored <= ((source->pushback)->current)remaining > 0Uprev != ((void *)0)(lex->sources).tail == (source)(lex->sources).head == (source)buffer-%pstream-%plexp != ((void *)0)isc_lex_close(lex) == 0lexp != ((void *)0) && *lexp == ((void *)0)max_token > 0Ulibisc.cat%s%s%s%s%s%s%s%s%s%s %s%s%s%s%s%s%s%s%s%slctx->logconfig != ((void *)0)categories != ((void *)0) && categories[0].name != ((void *)0)modules != ((void *)0) && modules[0].name != ((void *)0)(((lcfg) != ((void *)0)) && (((const isc__magic_t *)(lcfg))->magic == ((('L') << 24 | ('c') << 16 | ('f') << 8 | ('g')))))(((lcfg) != ((void *)0)) && (((const isc__magic_t *)(lcfg))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))lcfgp != ((void *)0) && (((*lcfgp) != ((void *)0)) && (((const isc__magic_t *)(*lcfgp))->magic == ((('L') << 24 | ('c') << 16 | ('f') << 8 | ('g')))))lcfg->lctx != ((void *)0) && lcfg->lctx->logconfig != lcfg(lcfg->channels).tail == (channel)(lcfg->channels).head == (channel)(lcfg->channellists[i]).tail == (item)(lcfg->channellists[i]).head == (item)lctxp != ((void *)0) && (((*lctxp) != ((void *)0)) && (((const isc__magic_t *)(*lctxp))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))(lctx->messages).tail == (message)(lctx->messages).head == (message)type == 2 || type == 3 || type == 4 || type == 1destination != ((void *)0) || type == 1level >= (-5)(flags & (unsigned int)~(0x001F | 0x1000)) == 0default_stderrlcfgp != ((void *)0) && *lcfgp == ((void *)0)default_syslogdefault_debuglctx == ((void *)0) || (((lctx) != ((void *)0)) && (((const isc__magic_t *)(lctx))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))category != ((void *)0)module != ((void *)0)level != 0format != ((void *)0)category->id < lctx->category_countmodule->id < lctx->module_countisc_time_now((&isctime)) == 0level %d: %s %d: isc_time_now((&oldest)) == 0isc_time_now((&new->time)) == 0channel->type == 3(channel->destination.file.stream) == ((void *)0)path != ((void *)0) && *path != '\0'%s.%dunable to remove log file '%s.%d': %sunable to rename log file '%s.%d' to '%s.%d': %s%s.0unable to rename log file '%s' to '%s.0': %sunable to remove log file '%s': %sisc_log_open: roll_log '%s' failed: %sisc_log_open '%s' failed: %slctx->category_count != 0category_id < lctx->category_countmodule == ((void *)0) || module->id < lctx->module_countchannel != ((void *)0)category == ((void *)0) || category->id < lctx->category_countlcfg->lctx == lctxlcfgp == ((void *)0) || *lcfgp == ((void *)0)defaultgeneralinterfaceinfonoticecritical3mem.cctx->inuse >= sizectx->stats[ctx->max_size].gets > 0Uctx->stats[size].gets > 0U(((ctx) != ((void *)0)) && (((const isc__magic_t *)(ctx))->magic == ((('M') << 24 | ('e') << 16 | ('m') << 8 | ('C')))))(((mpctx) != ((void *)0)) && (((const isc__magic_t *)(mpctx))->magic == ((('M') << 24 | ('E') << 16 | ('M') << 8 | ('p')))))mpctx->lock == ((void *)0)lock != ((void *)0)((*((mpctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((mpctx->lock))) == 0 ? 0 : 34) == 0limit > 0hiwater >= lowater((*((&ctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&ctx->lock))) == 0 ? 0 : 34) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('M') << 24 | ('e') << 16 | ('m') << 8 | ('C')))))Dump of all outstanding memory allocations: ptr %p size %u file %s line %u None. ((*((&lock)))++ == 0 ? 0 : 34) == 0context: %p (--(*((&lock))) == 0 ? 0 : 34) == 0file != ((void *)0)del %p size %u file %s line %u mctx %p dl->count > 0(mctx->debuglist[size]).tail == (dl)(mctx->debuglist[size]).head == (dl)dl != ((void *)0)((unsigned char *)mem)[size] == 0xbectx->stats[ctx->max_size].gets != 0Usize <= ctx->total*cp == 0xbectx->stats[size].gets != 0Umpctx->allocated > 0((*((&mctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&mctx->lock))) == 0 ? 0 : 34) == 0si->u.ctx == ctxoldsize == sizectx->basic_table_count <= ctx->basic_table_sizeadd %p size %u file %s line %u mctx %p mpctx->freecount > 0maxinuse = %lu (((mctx) != ((void *)0)) && (((const isc__magic_t *)(mctx))->magic == ((('M') << 24 | ('e') << 16 | ('m') << 8 | ('C')))))mpctxp != ((void *)0) && *mpctxp == ((void *)0)mpctxp != ((void *)0)isc_mempool_destroy(): mempool %s leaked memorympctx->allocated == 0(mctx->pools).tail == (mpctx)(mctx->pools).head == (mpctx) >=%s%5lu: %11lu gets, %11lu rem (%lu bl, %lu ff)[Pool statistics] maxallocallocatedfreecountfreemaxfillcountgets%15s %10s %10s %10s %10s %10s %10s %10s %1s %15s %10lu %10u %10u %10u %10u %10u %10u %s (contexts).tail == (ctx)(contexts).head == (ctx)(((ctx->pools).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((ctx->debuglist[i]).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(ctx->debuglist[i]).tail == (dl)(ctx->debuglist[i]).head == (dl)ctx->references == 0ctx->stats[i].gets == 0U(*((&ctx->lock)) == 0 ? (*((&ctx->lock)) = -1, 0) : 34) == 0ctxp != ((void *)0)ctx->references == 1ctx->references > 0ctxp != ((void *)0) && *ctxp == ((void *)0)memalloc != ((void *)0)memfree != ((void *)0)netaddr.cnetaddr->family == 10s->family == 10((((__const uint32_t *) (&src->type.in6))[0] == 0) && (((__const uint32_t *) (&src->type.in6))[1] == 0) && (((__const uint32_t *) (&src->type.in6))[2] == (__extension__ ({ register unsigned int __bsx = (0xffff); ((((__bsx) & 0xff000000u) >> 24) | (((__bsx) & 0x00ff0000u) >> 8) | (((__bsx) & 0x0000ff00u) << 8) | (((__bsx) & 0x000000ffu) << 24)); }))))a != ((void *)0) && b != ((void *)0)nbytes < ipabytesnbits < 8netaddr != ((void *)0)alen < sizeof(abuf)%%%u(unsigned int)zlen < sizeof(zbuf)ondestroy.c(((ondest) != ((void *)0)) && (((const isc__magic_t *)(ondest))->magic == ((('D') << 24 | ('e') << 16 | ('S') << 8 | ('t')))))(ondest->events).tail == (eventp)(ondest->events).head == (eventp)theevent != ((void *)0)radix.cfunc != ((void *)0)(&prefix->refcount)->refs > 0(&prefix->refcount)->refs == 0radix != ((void *)0)radix->head == nodeparent->l == noderadix->head == parentparent->parent->l == parentXrn->data[0] == ((void *)0) && Xrn->data[1] == ((void *)0)radix->num_active_node == 0maxbits <= 128prefix != ((void *)0)(prefix->family == 2 && prefix->bitlen <= 32) || (prefix->family == 10 && prefix->bitlen <= 128)prefix != ((void *)0) || (source != ((void *)0) && source->prefix != ((void *)0))prefix == ((void *)0) || prefix->bitlen <= radix->maxbitsnode->prefix != ((void *)0)j < 8node->data[0] == ((void *)0) && node->node_num[0] == -1 && node->data[1] == ((void *)0) && node->node_num[1] == -1glue == ((void *)0)node->r == ((void *)0)node->l == ((void *)0)glue != ((void *)0)prefix->bitlen <= radix->maxbitsrandom.cjitter < maxval != ((void *)0)ratelimiter.c((*((&rl->lock)))++ == 0 ? 0 : 34) == 0(--(*((&rl->lock))) == 0 ? 0 : 34) == 0rl->refs > 0(*((&rl->lock)) == 0 ? (*((&rl->lock)) = -1, 0) : 34) == 0eventp != ((void *)0) && *eventp != ((void *)0)ev->ev_sender == ((void *)0)rl->state == isc_ratelimiter_shuttingdown(rl->pending).tail == (ev)(rl->pending).head == (ev)ratelimiterp != ((void *)0) && *ratelimiterp == ((void *)0)(rl->pending).tail == (p)(rl->pending).head == (p)refcount.cref != ((void *)0)region.cr1 != ((void *)0)r2 != ((void *)0)base % 65536 == 0nresults <= 65536register_table() %s: %u(result code text not available)out of memorytimed outno available threadsaddress not availableaddress in usepermission deniedno pending connectionsnetwork unreachablehost unreachablenetwork downhost downconnection refusednot enough free resourcesend of filesocket already boundreloadlock busyalready existsran out of spaceoperation canceledsocket is not boundunexpected end of inputI/O errornot implementedunbalanced parenthesesno moreinvalid filebad base64 encodingunexpected tokenquota reachedunexpected erroralready runningignoreaddress mask not contiguousfile not foundfile already existssocket is not connectedout of rangeout of entropyinvalid use of multicast addressnot a filenot a directoryqueue is fulladdress family mismatchaddress family not supportedbad hex encodingtoo many open filesnot blockingunbalanced quotesoperation in progressconnection resetsoft quota reachednot a valid numberdisabledmax sizeinvalid address formatrwlock.crwl != ((void *)0)(((rwl) != ((void *)0)) && (((const isc__magic_t *)(rwl))->magic == ((('R') << 24 | ('W') << 16 | ('L') << 8 | ('k')))))rwl->type == isc_rwlocktype_readrwl->active != 0rwl->type == isc_rwlocktype_writerwl->active == 1rwl->type == typerwl->active > 0rwl->active == 0sha1.ccontext != ((void *)0)state != ((void *)0)context != 0data != 0digest != 0sha2.ccontext != (isc_sha384_t *)0context != (isc_sha512_t *)0context != (isc_sha256_t *)0context != (isc_sha512_t *)0 && data != (isc_uint8_t*)0context != (isc_sha256_t *)0 && data != (isc_uint8_t*)0context != (isc_sha224_t *)00123456789abcdef8؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[؞|6p09Y1 XhdOsockaddr.cunknown address family: %dsockaddr != ((void *)0)plen < sizeof(pbuf)#avail.length >= 1string.cstrlen(target) < sizetask.c(((task->events).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)task->state == task_state_ready || task->state == task_state_running(task->on_shutdown).tail == (event)(task->on_shutdown).head == (event)task->references > 0event->ev_type > 0task->state != task_state_done(((task) != ((void *)0)) && (((const isc__magic_t *)(task))->magic == ((('T') << 24 | ('A') << 16 | ('S') << 8 | ('K')))))((*((&task->lock)))++ == 0 ? 0 : 34) == 0(--(*((&task->lock))) == 0 ? 0 : 34) == 0last >= first(task->events).tail == (event)(task->events).head == (event)(((manager) != ((void *)0)) && (((const isc__magic_t *)(manager))->magic == ((('T') << 24 | ('S') << 16 | ('K') << 8 | ('M')))))task->state == task_state_ready((*((&manager->lock)))++ == 0 ? 0 : 34) == 0(--(*((&manager->lock))) == 0 ? 0 : 34) == 0taskp != ((void *)0)!(idle1 && idle2)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('T') << 24 | ('A') << 16 | ('S') << 8 | ('K')))))(manager->ready_tasks).tail == (task)(manager->ready_tasks).head == (task)!was_idle(((task->on_shutdown).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)task->references == 0task->state == task_state_done(manager->tasks).tail == (task)(manager->tasks).head == (task)(*((&task->lock)) == 0 ? (*((&task->lock)) = -1, 0) : 34) == 0workers > 0managerp != ((void *)0) && *managerp == ((void *)0)taskp != ((void *)0) && *taskp == ((void *)0)(task->events).tail == (curr_event)(task->events).head == (curr_event)managerp != ((void *)0)!manager->exiting(((manager->tasks).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&manager->lock)) == 0 ? (*((&manager->lock)) = -1, 0) : 34) == 0taskpool.ctaskpooltimer.c(((timer) != ((void *)0)) && (((const isc__magic_t *)(timer))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('R')))))timerp != ((void *)0) && *timerp == ((void *)0)((*((&timer->lock)))++ == 0 ? 0 : 34) == 0(--(*((&timer->lock))) == 0 ? 0 : 34) == 0(((t1) != ((void *)0)) && (((const isc__magic_t *)(t1))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('R')))))(((t2) != ((void *)0)) && (((const isc__magic_t *)(t2))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('R')))))manager->nscheduled > 0timer->type != isc_timertype_inactiveresult == 1couldn't allocate eventcouldn't schedule timer: %u(((manager) != ((void *)0)) && (((const isc__magic_t *)(manager))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('M')))))(((manager->timers).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)timerp != ((void *)0)timer->references > 0(manager->timers).tail == (timer)(manager->timers).head == (timer)(*((&timer->lock)) == 0 ? (*((&timer->lock)) = -1, 0) : 34) == 0type == isc_timertype_inactive || !(isc_time_isepoch(expires) && isc_interval_iszero(interval))type != isc_timertype_limited || !(isc_time_isepoch(expires) || isc_interval_iszero(interval))app.cin_recursive_evloop!blockedblocked(*((&lock)) == 0 ? (*((&lock)) = -1, 0) : 34) == 0isc_app_reload() kill: %sisc_app_shutdown() kill: %shandle_signal() %d setup: %s(on_run).tail == (event)(on_run).head == (event)!in_recursive_evloop*mp == 1isc_app_start() sigsetops: %sisc_app_start() sigprocmask: %sdir.cdir != ((void *)0)templet != ((void *)0)dirname != ((void *)0)(((dir) != ((void *)0)) && (((const isc__magic_t *)(dir))->magic == ((('D') << 24 | ('I') << 16 | ('R') << 8 | ('*'))))) && dir->handle != ((void *)0)(((dir) != ((void *)0)) && (((const isc__magic_t *)(dir))->magic == ((('D') << 24 | ('I') << 16 | ('R') << 8 | ('*')))))../entropy.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('s')))))source->type == 3(((ent) != ((void *)0)) && (((const isc__magic_t *)(ent))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('e')))))entp != ((void *)0) && *entp == ((void *)0)((*((&ent->lock)))++ == 0 ? 0 : 34) == 0(--(*((&ent->lock))) == 0 ? 0 : 34) == 0entropy.cfcntl(%d, F_SETFL, %d): %sstop typing. isc_time_now((&t)) == 0You must use the keyboard to create entropy, since your system is lacking /dev/random (or equivalent) start typing: sourcep != ((void *)0) && *sourcep == ((void *)0)get != ((void *)0)(((ectx) != ((void *)0)) && (((const isc__magic_t *)(ectx))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('e')))))source != ((void *)0) && *source == ((void *)0)use_keyboard == 1 || use_keyboard == 2 || use_keyboard == 3/dev/randomsq->samples != ((void *)0)sq->extra != ((void *)0)(ent->sources).tail == (source)(ent->sources).head == (source)ent->nsources > 0entp != ((void *)0) && *entp != ((void *)0)ent->refcnt == 0(((ent->sources).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&ent->lock)) == 0 ? (*((&ent->lock)) = -1, 0) : 34) == 0entp != ((void *)0) && (((*entp) != ((void *)0)) && (((const isc__magic_t *)(*entp))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('e')))))ent->refcnt > 0sourcep != ((void *)0)(((*sourcep) != ((void *)0)) && (((const isc__magic_t *)(*sourcep))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('s')))))Entropy pool %p: refcnt %u cursor %u, rotate %u entropy %u pseudo %u nsources %u nextsource %p initialized %u initcount %u !blockingn == 2!partial || returned != ((void *)0)errno2result.cunable to convert errno to isc_result: %d: %sfile.clength > 0Ustats != ((void *)0)pathname != ((void *)0)oldname != ((void *)0)newname != ((void *)0)fp != ((void *)0) && *fp == ((void *)0)w+path != ((void *)0)tmp-XXXXXXXXXXfile != ((void *)0) && time != ((void *)0)time != ((void *)0)../fsaccess.ctrustee <= 0x7permission <= 0xFFfsaccess.caccess == 0keyboard.ckeyboard != ((void *)0)/dev/ttynet.csocket() %s: %sretrieving the address of an IPv6 socket from the kernel failed.IPv6 is not supported.IPv6 structures in kernel and user space do not match.socket.c(((ev->bufferlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((sock) != ((void *)0)) && (((const isc__magic_t *)(sock))->magic == ((('I') << 24 | ('O') << 16 | ('i') << 8 | ('o')))))((*((&sock->lock)))++ == 0 ? 0 : 34) == 0(--(*((&sock->lock))) == 0 ? 0 : 34) == 0addressp != ((void *)0)socketp != ((void *)0) && *socketp == ((void *)0)(((socket) != ((void *)0)) && (((const isc__magic_t *)(socket))->magic == ((('I') << 24 | ('O') << 16 | ('i') << 8 | ('o')))))((*((&socket->lock)))++ == 0 ? 0 : 34) == 0(--(*((&socket->lock))) == 0 ? 0 : 34) == 0fd >= 0 && fd < (int)1024dev != ((void *)0) && *dev != ((void *)0)(sock->send_list).tail == (*dev)(sock->send_list).head == (*dev)(sock->recv_list).tail == (*dev)(sock->recv_list).head == (*dev)socket %p: %ssocket %p %s: %smaxfd <= (int)1024!sock->pending_accept!sock->pending_recvdispatch_recv: event %p -> task %psock->connecting!sock->pending_senddispatch_send: event %p -> task %psock->references == 0!sock->connecting(((sock->recv_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((sock->send_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((sock->accept_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)!((void *)((sock)->link.prev) != (void *)(-1))(*((&sock->lock)) == 0 ? (*((&sock->lock)) = -1, 0) : 34) == 0(sock->accept_list).tail == (dev)(sock->accept_list).head == (dev)destroyingsock->connect_ev == ((void *)0)sock->fd >= 0 && sock->fd < (int)1024(manager->socklist).tail == (sock)(manager->socklist).head == (sock)ev->ev_type == (((2) << 16) + 256)internal_fdwatch_read: task %p got event %psock->pending_recv == 1sock->references > 0ev->ev_type == (((2) << 16) + 257)internal_fdwatch_write: task %p got event %psock->pending_send == 1internal_accept called, locked socket(((manager) != ((void *)0)) && (((const isc__magic_t *)(manager))->magic == ((('I') << 24 | ('O') << 16 | ('m') << 8 | ('g')))))sock->listenersock->pending_accept == 1acceptfcntlinternal_accept: %s() %s: %sinternal_accept(): accept() failed to return remote addressinternal_accept(): accept() returned peer address family %u (expected %u)%s: too many open file descriptorsaccepted connection, new socket %psocketp != ((void *)0)(((buffer) != ((void *)0)) && (((const isc__magic_t *)(buffer))->magic == (0x42756621U)))iovcount < (8)doio_recv: recvmsg(%d) %d bytes, err %d/%sdropping source port zero packetpacket received correctlyprocessing cmsg %pinterface received on ifindex %uactual_count == 0Uinternal_recv: task %p got event %pinternal_connect: connect(%s) %sskip_count == 0Usendto pktinfo data, ifindex %umsg->msg_controllen <= sock->sendcmsgbufleninternal_send: %s: %sreturnedinternal_send: send() %s 0internal_send: task %p got event %pgetsockname: %s%d/%ssocket_recv: event %p -> task %psock->boundfdwatch-created!sock->listenersock->type == isc_sockettype_tcp || sock->type == isc_sockettype_unixlisten: %s!sock->boundsetsockopt(%d) %sbind: %sboundsockmgr %p: %ssockaddr->type.sa.sa_family == 1strlen(sockaddr->type.sunix.sun_path) < sizeof(path)isc_socket_permunix: chmod(%s, %d): %sisc_socket_permunix: chown(%s, %d, %d): %saddress == ((void *)0)pktinfo structure provided, ifindex %u (set to 0)socket_send: event %p -> task %p(flags & ~(0x00000001|0x00000002)) == 0sock->type == isc_sockettype_udpregion != ((void *)0)buflist != ((void *)0)!(((*buflist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)iocount > 0(*buflist).tail == (buffer)(*buflist).head == (buffer)sockets existtype != isc_sockettype_fdwatchisc_socket_create: fcntl%s() %s: %ssetsockopt(%d, SO_BSDCOMPAT) %s: %ssetsockopt(%d, SO_TIMESTAMP) %s: %sNo buffer available to receive IPv6 destinationsetsockopt(%d, IPV6_RECVPKTINFO) %s: %ssetsockopt(%d, SO_RCVBUF, %d) %s: %sisc_socket_cleanunix: stat(%s): %sisc_socket_cleanunix: %s: not a socketisc_socket_cleanunix: unlink(%s): %sisc_socket_cleanunix: socket(%s): %sisc_socket_cleanunix: connect(%s): %sstdtime.cgettimeofday(&tv, ((void *)0)) != -1gettimeofday returned bad tv_usec: correctedtv.tv_usec >= 0strerror.c((*((&isc_strerror_lock)))++ == 0 ? 0 : 34) == 0Unknown error: %u(--(*((&isc_strerror_lock))) == 0 ? 0 : 34) == 0i != ((void *)0)i->nanoseconds < 1000000000t->nanoseconds < 1000000000t1 != ((void *)0) && t2 != ((void *)0)t1->nanoseconds < 1000000000 && t2->nanoseconds < 1000000000t != ((void *)0) && i != ((void *)0) && result != ((void *)0)t->nanoseconds < 1000000000 && i->nanoseconds < 1000000000len > 0%Y-%m-%dT%H:%M:%SZflen < len%a, %d %b %Y %H:%M:%S GMT%d-%b-%Y %X.%03u99-Bad-9999 99:99:99.999msgcat.c(((msgcat) != ((void *)0)) && (((const isc__magic_t *)(msgcat))->magic == ((('M') << 24 | ('C') << 16 | ('a') << 8 | ('t'))))) || msgcat == ((void *)0)set > 0message > 0default_text != ((void *)0)msgcatp != ((void *)0)msgcatp != ((void *)0) && *msgcatp == ((void *)0)bufferlist.cbl != ((void *)0)5,0U ԙ D,0H  0ĕ(o\ooH8jINA5,(nSND89nSND:*V@VVV VW WW$DW$W,W4W@@X;JX6KhRRQQTQAP2\>;N6OXVVUUPU\AT2>h<Rh7S;BIND LOG V9 ܟԶ,<LT`lt̠ؠ ,<HT\htIN-ADDRARPA IP6ARPA IP6INT <  L 4Y xi k Y H |   f \ y <  L x  ܠ ] \ D d ] 4Y xi k Y H | 8 y f \ y ظ  L x  ܠ ] \ D d p ] ] y g ^ x u $r 8n \c a a ܟ l | | ܙ  {  l  4) |+  tp | d % @ 9 x   t n ? a  H ] L$   l  4) |+  tp | |9 % @ 9 hz   t n ? a  H ] L$ о < t 8 \'  7 5 2 . ` # ! ` D\ t[ Z , _ ; 8 x x  e122(2@2P2d2|2222222233(383L3`3Pt3l333333344$444<4X4h4|444444455<5P5d5t555555550123456789abcdefghijklmnoprstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2GCC: (GNU) 4.1.2Aaeabi4T .shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' /7oHHDo\\@S (\ ĕ eԙ`,k ,fqDDwXXdpk (k(,,00448800LL0"|H|Z p