ELF(4D4 (p444 %4((( /lib/ld-linux.so.3GNU{CRv9 TQl4zYSa:B3\*FWrsL(Zw05=Mb}ngm2A`.&Dc'>i1 h!j|N7E <ItH[OK@~X"qxp ),G_P V8Uu;Jo-6#%e]?/y$+kfd^d&ȚԚPuTNH 6(d4@L,X+dp4I|~>  N_ě8Л}ܛd$  d2$@0x<HQT'`<lP:xx0dTU`L̜8F؜dd|  d9,f8DmP\{ht`0e4<Eȝ<ԝTL<Xlt(,_4>@LLbXdp|<td~x|ĞTcО<ܞT0@i `<%$w0<9w<l&HVTh`(WlxXs8p9YH4m̟d9؟5|AO0P ,`,8DL\PHc\Dhxt:((PI@BQ@fȠ4Ԡ  h0@libnsl.so.1__gmon_start___Jv_RegisterClasseslibgcc_s.so.1__aeabi_unwind_cpp_pr0libc.so.6chrootsocketfflushstrcpyflockfileexitreaddirsprintfsrandfopenstrncmpinet_atonstrrchrperrorconnectin6addr_anyclosedirstrncpysigprocmasksigfillsetunlinkputcharlistenselectmkdirrewinddirfsyncabortstdinmemchrstrpbrktolowergetpidkillgetc_unlockedstrftimeinet_ptonchmod__assert_failgmtimestrtolfeofsyslogtruncatefgetcfgetsgetppidstrlensigemptysetopenloggetaddrinfomemset__errno_locationbindtcsetattrfseekchdirmemcmptouppergetsockoptclearerrvsnprintfsigaddsetctimecatopenstdoutfputcrecvfputsmemcpyfclosestrtoulsetsockoptmallocstrcatstrcasecmpraiseremoveopendirgetenv__ctype_b_locsscanfrecvfromcatclosegetservbynamestderrstrncasecmpif_nametoindex__fxstatstrncatsendmsgfilenousleeputimeschown__cmsg_nxthdrgetcwdfwritefreadgettimeofdaysigactionrenamecatgetslocaltimestrchrfunlockfilegetsocknamesendtofdopenqsortaccepttcgetattr__ctype_toupper_loc__ctype_tolower_locfreeaddrinfofcntlgetprotobyname__xstatunamememmovestrsepstrcmprecvmsgstrerror__libc_start_mainferrorvfprintffreeGCC_3.5GLIBC_2.40 U&y Uii 989e9o9t       $ (!,"0#4$8%<&@'D(H)L*P+T,X-\.`/d0h1l2p3t4x5|679:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ [\]^_ `$a(b,c0d4f8g<h@iDjHkLlPmTnXp\q`rdshulvpwtxxy|z{|}~-MЍ/-zƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌxƏ'ʌpƏ'ʌhƏ'ʌ`Ə'ʌXƏ'ʌPƏ'ʌHƏ'ʌ@Ə'ʌ8Ə'ʌ0Ə'ʌ(Ə'ʌ Ə'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌxƏ'ʌpƏ'ʌhƏ'ʌ`Ə'ʌXƏ'ʌPƏ'ʌHƏ'ʌ@Ə'ʌ8Ə'ʌ0Ə'ʌ(Ə'ʌ Ə'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌxƏ'ʌpƏ'ʌhƏ'ʌ`Ə'ʌXƏ'ʌPƏ'ʌHƏ'ʌ@Ə'ʌ8Ə'ʌ0Ə'ʌ(Ə'ʌ Ə'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌxƏ'ʌpƏ'ʌhƏ'ʌ`Ə'ʌXƏ'ʌPƏ'ʌHƏ'ʌ@Ə'ʌ8Ə'ʌ0Ə'ʌ(Ə'ʌ Ə'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌƏ'ʌ$  --0-w`dD-0 0S/D/Lt( 0S00/9-(M0 S R/Ѝ//-M Ѝ/\ @-@ 9!p@-MP`@ S{P0)So0 Ѝp@/A-M0MSp\ P|AoXG^p!Ql10`!E@ 1A` @`T !o` `0S2 R R@0 x/` P 0l@ hR0@ 0Ql [?` ЍۍA/3,99l :4 ( @ O-ʟJCMMXt@`Q0dS" 4S 6SDiS7 vS9 hS=,:@T Q: ,  @T S9 " j@ P  PS RPM9 9 |Y p l9 `)` P8@ PP P0 ((4(P bBQꜦ<TT4#S@P` ll(``.h(8\  P(  P ےԸ R B^P( nP 붸T#00(T#007 |^x7T(nA. B  nPˍ H0|8407(G+&v'\Q@T {@@ (p+0\o ,\0 0Q0000Xhĝ^ d `dh$LƟ 0S 4Ɵ -  00p b(D QP; DA B uPF+\B x8SL  Q^PxX(DX @H58 <D 0< 4P$>xȀ"R0D0 < 8 B~@#PP #pP #@P FP4b x P`dd XTPp@Dj4+P,4G $ P 4 P35  P  P3#  P# ,P3 | Pdh- TPH3`ŸPp`, P ,H2 }Ÿ  @Bb+P+SSjPU BFP1P@A0($"P?p+ p ,P 0SD108 xȒ\Ό  |8S,1X hP `dhĝ 0S ̓ 0 =ꌀT($Pl 4  H($ 4ЍۍO/l:h:> >X!t!4C>9!:900D0$>0t 199(I41D1L1l199T+|1l/11p>t>1x/111|/112/2,2D2/P2`2x2/222E22 3O-EMM$@P( 08A4Q0A(A ( R] _?@T tt p?pϟ/dP N0H/P8 P-Z ,A,G"PNB"P,0^0=U0S,@@>! @T> D^N Pi$p3\, ! (Q4=*4 @L  @ P ͟0S4@P`PE$ 0z4A9P e t9  v =S - (| ʍ$!^C}X #p=+R^:  4a @$$QN!@P B P@a A$qRHpLPPܸPPPL|PPDHP0lS; aS dSnSD uSMKPP P  P 0dS fS 2 P lzPP &P @nP$ P bP@DLHP44445454>0> 555@> 5(505 :85<5D1T5L1l19990t4119x19h>5953:59P(IP PK*01So  ;P< ʍAL @ >oPX,3SJ4xP(<,:Q4!^41PxXx 4A8 1  4D 4A<44Pm>4AxȄ,P14AD 4< J4 8-V 41|ȓ\  lL482 4A|(D, RA (^ 8:4:4@(A+p4 o$4!,P0 @0T000 4 X 8^ J 4!0ʍ81ʍ4!Q  -4@0M4H =4!p K[^`#(@0T0P0SX PS@@ Q #0S00N P 9 S S #S ;S Z,A,8#PNP 0\0 U0S,|@ @4/ !@T> u[$,P \@ :(^ J44!(,P0 00S000ʍ4@X@4Ppʍ41  4xH8!R  4!0 81 04S ̓ʍ 40-4 =4!  (!R4l ${3,L<'fP QߍڍO/E-!@M|@@@@@@p0\1`JP-Q@ 0mS$!$@@ P@ `FPV00娟 0NQ @@0 0Lt렞 @ \ | |Pp o[X0ЍE/(I IE5h:>xC>5:0>D>L> 59999h>p@-\aM0MSM HHQ P 兝$ P> v<@@D r P- ]@ P@P00S0 U0S@ $!@Td0 N00 P9AHЍۍp@/999953:5O-i@T0ƠƠCM^ČMSZ/Ȍ` T ^ @B= 80P 0P @^ PX  @ B 80(@ 8(@B- 0 8@  A,p^ WQG! @pD W<7Qǟ@' ^7 0T|<@7[B͍<\'^g:D@d< RP PMpTUG@0V\5  ƟV0!., ( $0   P .|P -V = STO V @&Q88&$\ <0PSU %Q@  0@:P@B͍5:96(6h46( 646L6`6h6t6p::66666666667IH7l|77:,m7X3777,9884@-dMp`P? T@l P|!9 @0S; hP7V#_D:\@8 45T4.@ R 0 4>#@\ ^ cQ0 R[Y\ lPTVpWn8 00  0DdЍ@/X37: 8<8P8\88|>88390@-M-$R44 0S  0/Q44 P^ `` h0\/$ 0LP44 80Z_$P@TЍ0@/ ;<;8E8;D>=@-d@\R" P000"00" Pd00d0 @/- M0_ Ѝ/m ;- MZ?cЍ/ ;-@-PM0H@S @  Ѝ@Ѝ/>99p@-P|m1 h(@`R88  =S @@ <1</ Q88 ^  0/(-0 0^VQ VNQ Eͅ$6,R>LQ tL l0]ldPEͅ 4 D0 ^p@/4X; ;3|;8;D>4d;>?`D0@-PPMxQ p0p/dcMT P0S 8@Y@ToЍ0@/ ;<8<>0<0@-@PM 2Ÿ/9P=S0= R00  P  2Ÿ/^00 -R HX X2DŸ/0=p R' tQ  L XR  2/p0L0pPt00 HX^  1/t H 0t0p0 r' P  T|^ <d `18/ T P00 P|0Q  1/P P 0/0S b A 0T 0\X&2|$2 P00l `0]Ѝ0@/ ;L<8d<t<<<<=4=d=`>=>D>@-@l R e0S P0S |0^ tt/h0h P\0HH/HBy@/(I====>X>`>= ;8\>==0@-PMl*M 0@S L0T  PȔ,M@Ѝ0@/=L>p@- 0@/XU88 `P  0/(R88 l`^ `` d0\/80<@$ ?\@Tp@/= I ;[>8,>D>-@-p0Md@dd O  X44 R 000S099>H>h>l>p@-@M`Pؖ  0-@T rt 4 ,\( $0$/Ѝp@/3 ; P>80@-`0`` MPT0`@PDH/ +/ $$Ѝ0@/D> ;\>@-@,0Q 4$@/Et@-Gll0 S\1\/P!PL14!_@P(<(> ;>8D><\>`p@-PP` 0/| |x0\ Y_@PPh". + +073p@/> ;8>D>\>0@- M`P@ 088\ (HT Ѝ0@/>O-M 0S  1A/,P 1Q/p+p*+GG%||.0P@|x`a0P@8},00 PT@dx|hl8},00 PT@dhlop p 0Q ,]000$( @HLpP`` <04@ D,]\P$( @4<0@ DHLpP`\P`  ^ ЍO/>(> ;>8>rt4 6 `0@-P M@ 0@S0![@P6 0/ ͔ -0ld`0 SM@- @ 4 = Ѝ0@/?d>? ;>8,?(I\?A-PM4 @@D^  0+P r p`f9 0h@Ph d`0\H @`8(|p@l*N @^VPލA/3? IP@-@ Xr @@/lp@-$C$m0S hdCP `ᩍB"Y`PU"PO"Q  2Ÿ/2^  2B/P Px t2XR/db R T P2(Ÿ/@2^ 0 ,2A/bP   2Q/A QQQ _A\ hA^ ƐAQ Rt0S2hAP \ZLA R @@0,!0$C^"<\00` u3P I`0Stbp@/L>??H>?E? ;?@`> =8\> =X> @(I @> <@(> >>>\@T>l@P>@|>@x><>@>@@K @L @>D>9p@-Am!i R" _0S !W0@S"0]AP ,R΀0M h =0S @ *T0,@+ ]U==  aQ  0/- ^ = = `0S  0/  @TP<t $ D0LS"0p@p4AE? ;?@(>@ @>,>DA(I lA8A @-@Mp0PS`PUPΆ@| ,RrPP0<0  `ʑ Ѝ@,A@>AL>P>-Ap@-PM(@] 0SN01` 8@0 ! y0S7|LXQ@t@ L X0Hp@Lp t08 0T((A0 H0 !  CZ@D@AA;V`P 10S 0/x0 @0@P| Ѝp@/AAT>B`>=$>DD(B8BL>dB\>xBB ; B B8BX>0@- M 2PR  1/!!A0S"0\AP/t 1pA/&P00 H^ 0! \1,/H R00 D0S ! 1/DD@T P @ Q 00SP1\ L >W8 |D x0@S"0 Ѝ0@/ ;2B8?6E?X>@C$C;4CDChCCD>@S@O-EGM ME΍$P0StTpT  4t/p: ,@pPP P G.pD-YG΍p 0tD;,P G> p0tD2,P(,P 0 RFEFN,p 0LP`V P \ 0 0sts`k 0^ 0MTfENtA^0=P0́ @t@D8W+^T r   R.sPPp00`SY0,`,0`,0E- ,PQF`0` LG@ < +G p`N`A`4 -@Rh mEH m\t+`V  ,@TJ WY  ,\ 0S  SZP `>MF\jhhM@h Arh$(R88  ͗\  1/8 =P88 -R  0/U088HXPX`FPV P X ͗ -( ] |ЍۍO/S(> ;>8CCCCCDd> DS4D\DO-PqM MT T P=P͟/D 0S $ 4 0= M/ - ,E_XQ \ ``}W ў Ϟ  E9@2E^ F ", **,*X^p0.R 0RL< Q@Pp,l$-`p \ $Q \\$$Q^ <p  9  yF$Mm΍ P `)k* 0UPP 4 4$MFm H ,P 0Q QMp@m. P` )* -0TPU  4 4mp k 42 1,pW 0^ \ʟMpPY`m @ )Q*: 0T@T  4m A+ k)lp 4 pB +R A VFP0  9,ɟ/qh QmPMP9,^ pW 0 RQ Π0S S @<0 `V ] $pW - (^ M`00  <+,PU 0P T(ppN BȠ\R040 40S 008~`P@| qGC7 f(^ $('^ (`Vx ]Pl8 ̖ЖԖؖ0f~,@6<`V ;E 8EN8L @4L+(q 60 @\ә C6 6,7@@ǝ帀ᰀ崐' gGP U 7@\@'g   t7xv D K $@ ǝ(@ (0S $ gW(  ǝ  ( m*\%XEPB`V @ 80H,E|$%VP  |4 ` 3M5@$(  9($\hQT~m㲐tğX|P@h`lp ,  K6  5 6 r7)VgHᴀǝP'@'090W fNl '**0`W0pp0 0W0ǝ 0R ``W0'ǝ   H8 9  9 =; ] Q0`40`TAV@P||"=  p< `d!0"$08P0 00 0000(0,04000``H0L0P0T0!UP X!>'| :' 6'3Z0``0-R@mM`MXUH1H ` P ,!Q 1 P CߍۍO/ ;<8(>>DD>Dd>D IDD0>ED E0EDEdEhEEEErtEEEEF0FPFd|>lFF>?FFF4 6 FFGG8GPG\>`G8>I0@-@M`80SG,QQ   1/A R 3 ^== 0S  0/- P MT = =@Q t 0p/0 D@ - -Ѝ0@Ѝ0@/G,>> ;W<@8(I^GG@-M|@ ,tt tl R" uTL<H @0@S"0fЍ@/E? ;?@@ @@-t0@ Qd0ddd/TMT @@NP ,@@V@/(>> ;8GG>@-P, M0pS  2Ÿ/`VAQ0C R 1/`@8 Ѝ@@|`''t!!(0W0@@0D@ TZ?0DZ@@0ADT@0T0`T AP` 0T`0PP D\?VdPd * @0Pݶ| |' Ѝ@/(> ; >8H`>$H= PHL>xdB\>xB`H BHX>$CA-PM  3R  3ß/P  3C/S#x `V"`s`0 `C^P(\ X3$ß/D@|T 4 03r/Q00 H^  2Ÿ/0H0 R00 DP p 2lr/Dppp,0S *@Jd"d "\0tS) @? z,^h $B$`2 0B0q\ 1/ w*L!C^'`P i*t!6X@$ $HP \ X1/Ltp^@LH@pptp  L@."0 Hߵ 0 0 .*8 H 00CS"0PЍA/ ;^ H8(>_ >EH?e ?\>@j Hm Hn DChCu @@`>H= PH ItIdBI @- MuPp!`]8 -0S Aw@>wT 8.@PvThr Ѝ@^ HH D1DA/8@w0 "! 0SwP0S Bw*wڱ P 0V R 0QpnP P Ѝ@/I$>DIJ ;B`>=>D(BL>)XJC@-@PL H0HH/<E40P0  @X @ < ;8lJO-P0IMS Q hh d?dϟ/XX!TT/4HY"8O0`( F Q ?Ο/ ` 0 pP  >刞/ XD R  T >PΟ/t^p00 H P ` \>Ο/p0H0pQt00 D R  >͟/tD0t0p04P PQ R ͟@T ,f  (T -,P' Ph @lfXMT BD 0A0P $ =̟/ ()t,4@T/L܀  xP'uPvu]xPvP vP vU P ? @w? w 0 PPG/E/o/@P=P3 4Q# T\ $ R  ̍ 1 ^$ 0P$0 (.| h+JT-\P !eP@  0  U" " +P"L +\L HptLD0 H咳Y< 0' *ZF/堊=G0S& JP E-$ ,h70X2m2H-D < 0R0!h00h0 d0S  9P E,P* ie l" @ U @N P TP:U FF= }'6 D<)!  \4^ V4 F$=$=< Z'g` (@TT\ 8^4 2Q/ -@R0=T `$4P :w͗\^ <0Sȟ R8 s,F< 'd'Dp@T% 0YIP d렗W@@@!7 Q dE$%ƟE$ +U0 @ ` 0S+ (^%ǟ(mq <S Q4PUP(P.qQQ@ 㡷 0 $ R ( P^B $͗\\0S< @T 0 4ğ/p R $MT \0S yş\@$DT` Rl$M4@TP  L  dF,PU ^+ @<<@H 0S  ş0 R. PT@@ 0T P@"0@T > @p@30P @\L  R$ ( V F; &\.@TDЀPN00004 0 @`1dAV!Pw.!$PbSP]4@4Q R=SZ =RS , ?S=@ F~*|@f0 S (@8 8͒\#::>^4 Q (\* 8l  ,@,P" (^@~0S00 ( t PU !P  \L4 eF; "(> ; >8xJE? ?\>@xB HJ H J JJ,>K ,K`>DK= PH dKKKKKN K0LdLL>dBf D>|>DdLLLF`hL?L0MHMTM \M >MMMM MNI$N@>A0Nj@NC0>E4>PNr`NtNSNNNOC O\OOOON@OtO$O@ ; E@Q $-RL  0S0 P 0@ Fx:{1SFn: $  @R" 0IߍO/A-PM  3R  2Ÿ/P  2B/R"`V"` @`XT 2PŸ/,P \\Bk$ 0BS08 42/ Y i$@ w!XPN )bpF? s,P 8Pp@b 0|ANPx X1/`!0<S 00 -$P P- @T  2'/ @\"G $@ 0 CR" lPЍA/ ; O8(> >OE? ?@ OP`> PH=@ $P@P h>( @- 0@- M 1R  1/A!0^"*P0@]#P d 1`/U =S P T4^-($!+,Q40SA,̈́s n,  @,-m60Gv+^ 00t8 P< @R" Ѝ0@/ ;! lP8EP?% ?@(>* >P@4 PP9 Qh>N @0@-pM(뵖P`1  T!P00 0S00QI (Q AGT0 Wz zT|@vq k@0 0MaNDB tp RL4Ѝ0@/DQ> >TQD>H>|QQL>QP>Q>T>QQQ><>RRE RG-xxMpEp5d%d5qPXPPPD<4@P % `P ğ0`Q P4$VP $D0`SPdT|$|`Dl6_DddPUD4 R 8 P,(ğP  Px@T*ȃp< `P0S S  @ .0J ((0\xß 8( P `d0XLS`VU x@$4 0 P @_ 09t@\ 4$5$5$545 5552 2 2 222FtY 2" pŸ0t APn _4 <*t\f tc r R_ +0  P, 8& @$Q!1&K`P! P@ P0t  \@GP 1Q 0  PCP J_  4 0rG \8xЍG/0R>D>X@R\RpR>RER>RR >R IRR9Rl/x/|////ESp>|>HSx>hSL6|S ;z\>} t>0@-P0lQ@ M ]Ѝ0@/@-`M.P@pP  P 0H Pd , 0Ѝ@ Ѝ@/PO-M P@`  P pᬐ, 7 6X@@ 7 & @P MDp2 pS㑏 Db P@@  @P 0 @ߍO/S0@-PM@X0P 0S Ѝ0@//@-@  -P P P @  .0P @@@p4[ 53SF6#Rt7P `;TЍO/Q8UyVVV,VCY@ zywlhЍA/W8Y8dAyBW`Y,Z@-41 MRP  1/ p0@1 `V00 4P  0/4^ 0 0 00S  0/ 0 t6@, <0@X>@T 0N> Ѝ@/WxY8YY@-@PMPp^ 1/0S 0  P PX S)0^ #b.@L`L@L@LD0\@ttP@ `@ 0<Ѝ@/WY8YDZZ Z O-,M !0TA`P@q ܑ8!0JAP@_ 8@@!@@@! T0Q0X衖q`y P Q p$1 (P,!0@14@AVl@8- e .  X@PA@P@0  `@PA\0`P00Tdd (  ! kFϠ.0p=,ЍO/W\ZdAyBXp@-@P`P1 x0x/UX2 X0P/0H 0@S  $?PRp@/TZ`Z8tZXTCC0@-@PPML H0U < ^ 4/ 00Ѝ0@/TZZXTCC8@-@P]8 40 , ^ $/@/TZZXTCC80@-@PPMP L0c @ ^ 8/U 0 0Ѝ0@/TZZXTCC8@-@Pm< 80 0 ^ (/@/TZZXTCC8@-@Pt4 00 ( ^ /@/TZZXTCC8p@-@PP``0`G X/0 S<@ <00ࠁ/,P `p@/[TZ8[XTCD@-@PJ8 40 , ^ $/00@/TZ4[XTCD80@-@PMP X0R P H0H/ 0SP 03:S00Ѝ0@/XTCDTZ4[8@-@P88 40 , ^ $/@/BTZ4[XTCD8@-@P88 40 , ^ $/@/JTZ4[XTCD8@-@P88 40 , ^ $/ @/RTZ4[XTCD8p@-PPM` 0R  0/@  PhP; 0B0\  ,0 P*@̅ TЍp@/XTCCTZZ8 p@-PPM 0R C 0/`@    PD0LࠃP; \`?V@Ѝp@/XTCCTZZ8O-P\M` 42R , $2$Ÿ/ 2Ÿ/[ 1/?Qe X 1Q/ p ( ,0 4 8 < @ D HLP T      $ %,@0 /-?@ @  0, 0  0  s< -P@TWPgU P PPP   0P/@@pG\ЍO/XTCCTZZ8[\(\nSNDO-@PP Ϡ0 f` 0 `0? 0!  `pG`PE `U 0<ЍO/XTCCTZZ84\nSNDp@-`PM\\ X1X/PU <1R 0 ,1A/P y 1/Q  0@/^  0/ObP)O\P#0S00<{d l` @@ /0F:@Ѝp@/\\8kool\(]H]d]]@-@P 0R  0/P :1S \! ^L\ X0H/AP,, @/kool\\8]] ^0@-,1 MR@ Z 1/0 PP 0P010, 0904P 4< 0948P 8d0< 9080@ R<@ <P<< 09 Ѝ0@/\8Y8osw}G-FMM7-p,W tQ l d7dG/`PUP<@',Q^L⫯) -(  ) dP  6V/ᎏWP  6f/!@0S <PP \6HƟ/!@<s <Q<| Q.R<` @@0\ ` @PTP`Y!@0S <P 5ş/!@<E <Q<N^ HY X5@E/D5a@^  P0 @@@p 0R`PPPHP0`, @\  4D/,0D^ l 4d/ATl4V PVe V,$n0"<P`J (  r1`POP <#z0 <P  0_P@ <x#0;P @!048@0, 3@@s8Z qP 8 < 2e8,P 8P<o,0<Q 쁗@ <X_.`P @[ Pm :j`=V /`<Fn F.01-P , (2/_`Pe-@=B j`|=VV8@N,P\(  (0 d .0 51`RV:POPOP, R <Q<8,80S8&8 @HX aVZ!`U !y,`{pezX0CQ L|  `P`.P: 6hЍۍG/_kool\\8]8^h^^^z^_!4_ ^O-M 0!1;pP@d @01L@DH0!P@N l10 졗@,y0@QD4@P8@a <@!`@@Af@<' ! ' .@Pz ALAAAP pP00Tdd Y  e@/0-7ЍO/\hokool]p@-0 PR`H 0@/TI 0 ^ x/`^J `0P/,4 ^L 80$/p@LX_\8\kool|__0 .P P0 P00/0@-MP@`Ѝ0@/@-@P88 40 , ^ $/(@/2__xtcD8@-@P88 40 , ^ $/$@/8__xtcD80@-@PP M TT0T \D/4 06 Ѝ0@/_X`8@-PPp`@M 0 \ x/l0(P 9P0 p`@   $000Ѝ@/_`8O-M@Z1 ߤۤ p`W   0S4:`P U@ @ PU`  pZZ 0/ |  P`%P!* U@ @ Pd`U<  ЍO/ _`8 E- 4MR@`PPP1P/POO&&  O&00* $p d $,  - ( PP$ $ M , 0jP@ P   (0S $ @8  p 0@d`@4ЍE/_`8@-@P|| x0 p ^ h/H0SH 00(C\0,, 0@/>__xtcD8`B a0@-@PMP 1R  0/U P A 0/0Q ] R 0|/ P Ll h0H/ 0BS0DD =@Ѝ0@/xtcD_8a8aab,bDbE-PM`@0P l1R d \1\/ P 4< 81,q/@ @ @0pP8 `d`& 0P @6P 0d  0 }P @e=P p 0  d  Qp  ? ЍE/RSND_pb8b@-Mp`@P0P0 0 " P}ߍ@/c_p@-`M@ 0PP  Ѝp@/O-`PdMP 0p 3R  3ß/2P P\ X3L/`d [\ 0,  @:0P \ d\04Ƞ0,Z0 Q+ \ 0P@"0J@P@` p2\Ÿ/TuXP: T\0 \0 Q\ 0Pj @5Pd \d@\@A\T  0APU! RpHPLn<PG \0h`  0tP;^  ,P# /0@@ 0a pPTX R T !P @ Pd`dЍO/RSND_gpb8k$c,90cLcPc`cgO-M4M *pX@P0S G  [/P#s J(\p, (070P@E  O A2<@z3 P?YPPU@Y 2貟/  2P0 Q AT 2Ÿ/!\tP x  R()H20B/0 d2S ` ^)   %3P  1A/* ʍ \ $0@>:\ `d 0N@T!H1@`"6@P0 $2 eT : $ \0@ @P I0 l    S0 Qa[[1Z  4ЍڍO/_lc|c3c8{cg`6c$ccc1ЍE/_P :P A⿣ BO 4TPᶣU h!PU UTPh@P=BߍA/@GSM h `h8 Lmv $c+ 0@-@PPMtt p0 h ^ `/h0 hhR@0\^h0P DPЍ0@/ hY `h@GSM80@-MP@Ѝ0@@-M0  #@ P \0  Ѝ@/@-2MdPpU R || x2xb/WT` \2PŸ/h0Q $8 42 b/`P\ R`u h@bq P @$,J`Pe|\`V# >P t 1pA/d@\x  ET`PFh  Q @a$ @<8`P  1/d@`T  !T<S`eV`` < R Vd 0`/ @^< P h V`XЍ@/w@GSM h `h8 lm m6# $c(5 &'H m70@-M@P 8}0S ֟P 000 Ѝ0@/@- 1$M Pp`U R  0@/W 0/V Q  0@/`P@ x@P`  ' k@P  $Ѝ@/w@GSM h `h8 tZ m0@-PP@M 0 ^ /T 0t ^l/^P@ P0@/@0 00Ѝ0@/`h hm @GSM8n jmq @-X0@S l R lX5PD @0@@/XX 0X@/n h80@-PP@M 0 ^ /T| x0` ^X/P <0 00Ѝ0@/`h hY @GSM8Z j^ @-@P 1R   1/hP  0/0x0  H ($ 000 R Q^P`P r`&\P k\@@/@GSM hv`h8wip@-p0@S` 40p0`PUG P 1/P 1/V Q  1/` `(`L!d1``P $!@1`RP[ 1 00`0 PVQ  0P\P$ -P 0P/\\X 0PP\P P% P0P\p@/ h(n8Pnpnn  G-!(0`wPq Z00 P  1/@T 0 0 ^ xx |1t/ 00$@  : pW00 (P , (1/(^ 0 0 $0S  0/ $ Ps 0/[` 08@TP( L0* PU`YG/ hn8noo8o@-@P4MPp`0 /  (v,0 S @80WU @ 4Ѝ@/ hXo 8@-@0$ "0P @ @ @/ h@-@P P 0P   0 @@/0@-PP@M 0 x ^ p/TL\ X0 ^ </0p30Ѝ0@/ h`h' @GSM8( po0@-@MTP'  R00 0S  0/Q00  R  0/00P@ kP \    Ѝ0@sЍ0@/ hKo8o0@-PP@M 0 x ^ p/TL\ X0 ^ </0p30Ѝ0@/ h`hM @GSM8N po0@-@MTP'  R00 0S  0/Q00  R  0/00 P P @Q  @@b#Ѝ0@/ h*o8p0@-PP@M 0 x ^ p/TL\ X0 ^ </0p30Ѝ0@/ h`h3 @GSM84 po0@-PP@M0  ^ /Tt0`%  ^ P/H ,P  . Ѝ0@/`h h? @GSM8poB @-@PM`  1R 1/P  1/VU wP@P; P6 p L`P P+  " 0 2# `` 0S   0  |P 00 Q R 0S Ѝ@/@GSM] h`h8^ pn0@-PP@M0  ^ /Tx0dt  ^ T/8L /P  M Ѝ0@/`h h @GSM8po  p@-@P`dP U@@Tp@/G-PM@P,`0p帒dd `1`/0S8D @14/T$ 1 /V P  0/UW 0 W Q 0 /(  P| P V00U 0 H0PЍG/ hpi8HldkP ,0,<QptP0p0PU ih0 0i0Ph$Ѝ0@/@GSM h`h8 qp@-PPM`@ 1R  0/T 0/xP  0/hQ t 0p/|`l  Rt0R:  x@Ѝp@/@GSM h`h8DU0qiA-@PMP X1R PP L1L/U(4 01$a/  P 1p/ Qp`^ 0S$\ 0/ 5 ("ЍA/@GSM h`h8dkLq\qO-PPdM  |5R tt p5pş/x RLXX5Le/[(< 85$u/዁([ 0(004(  ( 4`(`4xt `0b0t,Q 00p, ,00`V_ $X\ TpWWx@8q0` 0",0YD 0  0| Pp\ 0 0| \p x0t 0 W000 Y: @ <3C/ .|;x@8D0 pXxt  000p ` `$` p$p0#[Q \1S S.S 0S004 R00(Sbx@8p` ",Y0D 00 0| d\0Pp 00 | 0z\ pxt 0 W Y:( 1@/ !|x@8D0 0xt 0000qW  KR0 0Ó0$`Vt Xm(0S(\xpt  0(p 00dЍO/@GSM h`h8qq_ r0@-PP#P``@ P\ 4\@\ 尐\08\ \``\`P  #$(` D\0`(@\00 $0`(``` ` @`0(0``` 80Q ` @Q5\`\@0\p p\ )X0\pX@T``@X`.ἰ0!20@`D0S \ R`\0@`@` X ` R``0``` `@ R [0P!<V `4!P1`[ 4 010A/V  1/,0,0, A P:@0S@# @`@`[ 0p 0xV `T 0q@dh@@@`X@@lЍO/ h xDrxr8r?O-pPlM  h6R `` \6\Ɵ/X8D @64f/hP  6Ɵ/ `h0!hh`h`\ `0 S`]%E@ hD`0 $h0@ (@@/U@P! P oTEX D0`Pxd P Q `Vi 00P @@ @#4dd`TX@TXLId `r d  Q 0S   0 P \ @P 4X#PP  ` 崠 2`P @(0S P($P @(P```Ps:@T` b`|"2 ` dG 2`Ÿ/@"t25 @VQPRP2VP V{PhD `h`0\P  R`;VP VdD 0IPQ`(1PP PQ`D 0`6P  R`\ PP P>\a`^` ,,a(!(0@@i` j, 0P` $幤i i VPU``  P{ r`d` @`x@`vlЍO/@GSM h"`h8#Xo$m%Oxrq?/@-@P 0 x ^ p/P P0H/0 S  @/HwPwnSND8P0@-PPM@ 1R  0/T Q  0/0  0/0  0\  0 0S  R    Ѝ0@'Ѝ0@/nSNDHwz8<{{@-`PMPp |1R tt p1p/U DQ < @18/W ^ 1q/p0  0/ 0 aP3":@@@崙  R@ P  R  埙Ѝ@/nSNDHw/ z8|1 8 00@-@PP M 0 ^ / ` ll0`/  L 000 Ѝ0@HwPwnSND8\@-`PM@P 1R  1/ Rp||1pq/U DQ <P L18/ , (1 q/0S  1/p0p p p 0 P   @@0 0T    Ѝ@/nSNDHwtz8uv<{w{x@-`PM@P l1R dd `1`/ R<HH1@-pR4M@`Pt0ttt/ G @P(@ @( ,0@&4Ѝ@/0Hw 8tp@-CM[@P`P0  ^ x/ @+ B@P,,$(4岔Cލp@/PwHwnSND84O-PPM `ࠝ 3R  3ß/Z Q@T sX`m h3\C/w `V$8 43 /  3Ÿ/[8 ((  ``  @ p0gS0# p`40  $ 0 R0 QVANNNN?R(04P00UR p`p`$-B?QORM 0a ?p p`p,@T1 pW ` pW  ^K*  ```0 DD!0$0@.Y#2QT1  00  x40S,F,FX@Hm P0/@pT,p68PLЍO/nSNDHwPw8!fuB4[PaH  O-@P M D2R << 828Ÿ/   2R/[ `V  1q/ P UZbp` 0SY] .`@IP0C @A0SI ?SpPE.U*8X T14/A0A0 ASS RaA-Q\_QT1 P 0p@DT( 孓`@DpXPE  CT .J@DZU TUTQ ^@ d ЍO/nSNDHwPw8!fuB 0)@O-PM P 6R  6Ɵ/P Q  6|F/Q p`fWq@T{ @ Zwl 8 46/`@P  6ş/@T00(@(0(@P ؠ `p n0Y `1`# Pap 0  $ 0J@U񟗍UTUUTV\VV.TZ`F$@TZP} \T`F0 p pP rV pPp.T@T  P[@Dl h4@ğ/Z(P P`F$PN\TPK 0>S,`FQ4@@@@@=[T 0  >P,\3@@PP  0    0 @TP>\,0PS03@0@0@@`FP#0   VZ $ R\ m$ RjV{ Z x 2tŸ/UUU@T4| x20Ÿ/0 @[0 H 2/(  R= PV(0%`% .*F@?T 1/dPA@, pR1pp0QUp` [x @1A/U@ 0  6#!,`,`0PaD\ X0@/@T,xЍO/nSNDHwPw8!fuB4$Puaa,@LX@-PPM` 81R 00 ,1,/V 1q/  0/pW pP g@T@#T@! ᔐ  0S0#0Q   PnЍ@/nSNDHwPw8P0@-PPM@ 0R  0/T Q  0/ 0R P` \0H/ 0R夏p3Ѝ0@/nSNDHwdx8xdy0@-@PPM LL0L D ^ </ 0 SЍ0@/HwPwnSND80@-@PPM <<0< 4 ^ ,/Ѝ0@HwPwnSND8p@-`M@ ۏ0PP Ѝp@/0@-PMP| Pp P  P\ PT PH D@0 4 KЍ0@/h|tdlp@-,MP@p`P@  0\ +% B,Ѝ@/t0@-PM0  S P@ 0   Ѝ0@/,9 " \" " # $E-MPh` a0@S񟗂`hb`hbhbhbhbaahbhbhbhbbhbhbhb : 1/Q 0/!0@R 0/!0 0SX 0T/  0 8#(Q!@/ĊQ܊8RS (_Xagċ0@-@PMP<< 828Ÿ/0*S  2 Ÿ/P  1/U] 1/ RQ1/!1R\ 1X/!PH R P L1/1!CR$ 1/!00 Q 0/ 00 !0!0P/ 1 000Ѝ0@/Ċq܊8rs )u(v~Xċ@-@PDD @0@/0  00000 @/8@-@P 0/0hsl h0\/ @L H04/ @/#8%(&X0@-PP@M 0/T 0/ x 0p/ PO `0H/ 0 PP 0 Ѝ0@/|687dk;@-@PPp`M0 /Ul] p0h/ HT P0@/0 0 p`Ѝ@/r8vX0@-PP@M ||0||/T\h d0X/ 8a @00/00Ѝ0@/8X)PD/PP9*PP5*P3 /<P/P"P5  P2%&P#'P'.cP -P,P**P +P0P"1PP/fPgPPP#/!P0P//A/@~P@D/ ///@-0@SDD @0@ࠑ/0 ̀ @/Ԍ8@-0@S00 ,0,ࠑ/ @/8@- @R$$$0$/0@/8p@-0M.S P  `@ S <0<<</ #  Ѝp@/,!81P*P*'P )P PP*c0@S,P//@ (~R/PP0/S/gPcP *'P )0@S P:PP//0@-P MP@)0 30S0 0 Ѝ0@/A-M`P \0 @00@" 0QD0 @0KT\H z=p 4 C|@ @GTD FDLD p @D@p R2ggP00g@[gg@Qg @p g@UGg00Ug00ЍA/᱄^ 90@- P0@ %P\PP M    0S0 @0 Ѝ0@/p@-M@ P`0U 崉Ѝp@/@- QM`p@P o 0/Tp 0/0S q 0/P |r 0t/P P P Ѝ@Ѝ@/@H8Xo\|@- QMP`@p ` 0/Ta 0/0S b 0/P `c h0X/ RQ,d<0(/!Ѝ@Xꠍp8Xo؍p@-`M@ 0PP Ѝp@/0@-PMP RP &P P P PPl d PX PL D P8 0P$ P P  P |P P tP p/P )&P "P  P `$Px} pz\+Pdv )PXr Po'PeR-P<i 4fNP(b dP^ 1PZ 15W:cPM@fPQ 15N:gPD:PH PD A2P= 15::1P/+41.+(|%t"ld\TLD< 4 ,@0 !᠈Ѝ0@/Ἆ\$|,0D<@PTphl| ЎĎ̎ T<0(HDld8(dt@(8Ldx؎8L\|@-,MP@p`P@  0\ GA B,Ѝ@/tG-M  l` @0SP 1/UU "`PE/ 0B^SUPEI\d d0 zd d0@@ d p0@;R"R \RUPE'\UPE" 00Zpd*U " nC@ @R*D H0@/0d ЍG/8E-PMUp= 3`0 S!00wSf B6S! Ss SR S SSw S"Sy S Sh2S 4S 0S\Sz DS :S CS HS PSd ESiS, dS hSqnS pS mSS| Sn S  zSU ~SSE S& SS S SS Sg SzS S S SS S SS S S#S_ S1 S^ U ΆU~ džUw  PUn \ 巆P  Uc 4 嬆P0N zU  ᡆPUPtUM 喆Pg hUA 劆P0, XU6  P  MU+ h tP0 BU @ iP  7U  ^P0 U SP  !U HP$0 U =P  U x2P 0 U T'P#  U0 P 0 U P z U P0 U P d U P0 U `P N U 8څP0| U υP 8 U{ ąUt ὅP0_ nUi ᲅP   媅P6L xUV h埅P0A mUK @唅P  bU@ 剅P0+ WU5 ~P   vU& oP0 =U dP  2U lYU  TRU <KP!0 U @P%  U 5P&0 U *P'  U P)0 U tP* } U L P+0 U (P, g U P-0 U P. Q U ݄P/0 U ҄P0 ; Ud DŽP10i xUs 4弄Pc % Uh ᱄PeU_ 娄Py{UV ោPg0A PUK 唄P  bU@ |剄P0+ WU5 T~P  LU* ,sP0 AU hP  U ]P00/U QP  E\ EP@ E~  N0 q 3P #RЍE/ᨈ$[Nďȏ̏Џ؏ @4 $048<DLTX\`hltxC,ĐOO̐ԐPE-`PMpXX T5Tş/W0< 85,ş/ 0   5ş/Q3 Q! Q ,Q Q(Q! $Q; Q F#Q Q Q !Qi*Q $Q @P@PPB 4ß/0A  b7@PP@P\h T3<ß/0 A 7 /P /P PU@Ⱐ OP 2xŸ/  0N!`'`%@T5PUHH (2b/00C0 sRSR aRAR @Q`S*u 1/P d@P* d1L/PdP0@P*<D 1/P d0 0%V "$PU!@Ⱐ Q x0`/ 0 0C  0 /ЍE/687ܐX$<9Tlp@-08M SP@`  0/P&P PP 0@Pr7@PV 8Ѝp@/ᄑ80\@-0T< \^* 1/\X f0 X0\ ; @  XP 0 @   0S\ X@`@/PPlЍE/M8N\OXl@-@Px t0t/0X,S T0L/ P $ \0  @/8(@-@P|| x0x/0\+SB X0P/ P ( \00  @/D\8p@-@PJ 0/0*S  0x/P Td `0L/ P Q  40 @/ĊXo8)* /@-@Px t0t/0X)S T0L/ P $ \0  @/ሕXo8@-@Px t0t/0X%S T0L/ P $ \0 Y @/ܕ8@-@P 0/0S  0/#P  0/ P Q p 0%Q P l0  $Q ( L0$, 0 0@/TXo8 (@-@P 0/0 Sdl0l`/ R <0 P80 <0 0@/Xop8D@-@P 0/0S  0/ P Q d 0Q @ 0Q 0  0 0@/`Xo8|@-@Px t0t/0XS T0L/ P $ \,0 y @/ᘖXo8@-@P 0/0 Sdl0l`/ $R T0 P80 MT0 0@/Xo8Ж@-@P 0/0S  0x/P T X0L/ P Q  0 @/Xo8 @-@Px t0t/ P L \0 00, P0  @/<Xo8@-@Px t0t/0XS T0L/ P $ \0  @/XXo8t@-@Px t0t/0XS T0L/ P $ \0  @/ᐗXo8@-@Px t0t/ P L \0 00, P0 z @/@Xo8@-@P 0/0 S  0x/P Td `0L/ P Q  J?G @/ȗXo8!"@-@Px t0t/0X S T0L/ P $ \0  @/᠍Xo80@-@PM 0/0S ] 0|/&P Td `0P/ Q PP  Ѝ0@/sXo84uL@-@P 7ǟ/ R 9 R% R R Ro RR R R R R R RR R  R RR RR R RR *R !R R R RR R%R #R $R'R :)R0R -R +R ,R.R /RgR+ 1R cR}RG 5R_ Ru)0S SoP  5ş/Q`  5ş/W R th5  QL < D0S{ 445 ş/r@P4@@sQ 4 @A R 4 ğ/@ @0S@P?@r@GQ Q y@@@ R Q\@p0S$P  3tß/ Q@3Q@ Qz@ R@@@j Q 0S(, TQ "2n Q $ TQ "2b/P  2XŸ/ Q  <Q l"O?_<} P| Qw H"H2q0Ss Pp Q$"0h cR  2/ P\ Q!0T PS QN !0*00H QG LQ !1LTQ7 \!~?T0 R/ Q, LQ !1LXQ 1 0X0P B 0P/ P Q 0 @/%Xo8dxt̑<pl p5 XĜ t@-@Q @/A-08MSp`  1/P  0@/V 0P/ R0/P  0@L@B P 8ЍA/Ἑ8HdkA-08MS@P 0 (1(/U 1a/ R0p/ p 0`U4Qp x0h@/040A@004l QP 8ЍA/$̒8dkA-08MS@P 0 (1(/U 1a/ R0p/ p 0`]4Qp x0h@/04@0A040  P 8ЍA/8dkG-08MS@P x p1p/UP P1Ha/ R(01$q/  0L p B  `P$ @4^* 0/040 d  <@004 #  P  X`8ЍG/ 8dkA-08MS@P 0 (1(/U 1a/ R0p/ p 0`/4Qp x0h@/040A@004F +P 8ЍA/ 8dkG-08MS@P x p1p/UP P1Ha/ R(01$q/  0 7p x  `P$ @4^* 0/040 d  <@004 Y  P  X`8ЍG/̑48dkE-P R-  R2 R6"0S S S.Q   k! R  OP@DT dP P <P  ᫺  @` Ѝ@/L8Xo!"0@-Q M@`Pp | t1t/UT T1L/0S ( ,1 A/P  1/< R Q# 0@/< R ^$R 0|/<0 SRPh0L@/ : ᨞P @$<t Ѝ@/p8XoPḷ@-Q M@`Pp  0/V  0/U 0/0S l t0d@/P @ L08/   @U Ѝ@/Ἑ\8Xo@-Q M@`Pp  0/U 0/0S  0@/P ` h0X/ ᧹ P @< ឹ   Ѝ@/p8Xo4P@-Q M@`Pp  0/U 0/0S  0@/P ` h0X/ _ ͝P @< V ĝ Ѝ@/̑8XopA- QMP@`p  0/T 0/ ^p0\\/ ^L044/  ምЍA/ᄑ8XoФA- QMP@`p  0/T 0/ ^p0\\/ ^L044/ ޸ LЍA/H8Xo A-QMP@`p  0/T 0/ ^p0\\/ ^L044/ ᢸ ЍA/t8Xo,HA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ f ԜЍA/᠓Է8Xoh@-Q MPp@` @@ <1</T$ 1/0S G 0P/P  0/ ' ᕜP P<  ጜPhhPlcP p^PtYPxU Ѝ@/ᴑ8XoA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ Ƿ 5ЍA/8XoA-QMP@`p  0/T 0/ ^p0\\/ ^L044/ ዷ ЍA/8Xo$@A-QMP@`p  0/T 0/ ^p0\\/ ^L044/ O ὛЍA/<$8Xo`|A-QMP@`p  0/T 0/ ^p0\\/ ^L044/  ၛЍA/h88Xo0@-P MP@)0  *͗0S!00 Ѝ0@/@-PxMUp@` ` X1X/T8 810/0S  1/P  0/0S S!R 0  ^ |0 t/P0P +P!Ѝ@Ѝ@/tئ8Xo$8@-Q Mp@P`  1/T [ 1/U 1/0S `x t1\A/P 4T P10/@P=  p Q5D("2P,@P'(P"#PL$hP 0SP  PP%XN @@ Ѝ@/k8ԶmXonLol@-QM`p@P `` \1\/T8D @14/0S  1/P  0/NP)<P$@PPPPL$P P%TЍ@Ѝ@/ ^8_Xoa@-0QM`p@P  0/T 0/0S  0/P x 0p/SPP P!Ѝ@Ѝ@/ ħ8XoЧ@-.QM`p@P  1/Tdp l1`/0S 8L H14/P U 1/T RQ0/P(P#PDP?P:PP $fP%TЍ@Ѝ@/ᰛQ8RXoS <U\@-+QMPp@` \ T1T/T4 41,/0S  1/P  0/0S SQ 0 ! R x0 p/tP P P!Ѝ@Ѝ@/D8Xoب@-%QM`p@P  0/T 0/0S  0/P x 0p/$PP P!Ѝ@]Ѝ@/$8Xo@-$Q M@`Pp  0/V  0/U 0/0S  0x/P T `0L/P ϳ  @< Ѝ@/l`8Xo<X@-#Q M@pP` $$ 2 Ÿ/W  2/U 1/0S  1/P | 1x/ RQHpp1H/ R ^QD1/$ R(0S1/XP,SP'P" P P P(P $( }P, 5  @ᢗ Ѝ@/T>t8?XoAxBCE0@-!Q M@pP` $ 1/W  0/U 0/0S  0/P | 0t/PP P Ҳ  @? Ѝ@/<8Xoh@-Q MPp@`  1/W  0/T 0/0S  0/P t 0l/P Ⴒ P P@ y  Ѝ@/᠒8Xo@-QM`p@P  0/T 0/0S  0/P x 0p/1PP P!Ѝ@jЍ@/ᘖ8Xo@-QM`p@P [ 1/Tdl h1\/0S 8H D10/P $ 1/T RQ0/P(lP#gP"PPPP $DP%TЍ@Ѝ@/(8mXon o<\@-Q M@`Pp  0/U 0/0S  0x/P T \0L/lP o  @ܕ Ѝ@/$8Xo8@-Q M`@Pp  0/U 0/0S  0x/P T \0L/'P *  @ᗕ Ѝ@/ĸ8XoX|@-Q M@`Pp  0/U 0/0S  0x/P T \0L/P   @R Ѝ@/ظ8Xo@- QM`p@P X P1P/W 0 01(/T 1/0S  0/P  0/ RQ|0x/ 8#Ġ"<P {P!Ѝ@Ѝ@/ȗ\8Xoث@-Q M@`Pp  0/U 0/0S  0@/P ` h0X/ = ᫔P @0$.) Ѝ@/ᔔ8Xo<X@-QMP`@p Pr H1H/T(s (1 /0S t 1P/P u 0/Q  Rv 0P/PU` 3N `0`  VhP Ѝ@)Ѝ@/X 8XoD`0@-@PM 峐坑Ѝ0@/p@-MP`e R 0 @Tq T Mἑፐ Ѝp@/G-*QM@4  1/T  1Q/* ? P0UP_SXop Pd h1\A/  `L V ``  $1A/  0L 0S@ 0/  @T"W WT VTVT  0\S  d 0S8  Q$)ЍG/Ċ8A-*Q0Mp`P H @1@/V ( $1A/U 1/0S  0@/P A 0/ RQl0h@/ @!ێ᫏ᕐ 00ЍA/Ċ8Xoج(O-PSW $06 00W &0( 0"U 5ş/)P  5pE/^  5Dş/ R1Sx|5E/(!, (, (׾@,P 4ğࠑ/,( @0Rd(0, g:(,,0(S CS^W= 0 0U 4D/,^ \ T4ß/ R 0 ,4C/@P @P! 0 0% 0 0yWUt 2Ÿ/01S H @3B/Q  3Ÿ/ R2tB/ }U D2DŸ/cP  02B/^  2/ R 1SH 1A/(,,@^ 1p/,( @0Rd(0, (,,@(T,U^ 1/g^ p_ h1@/ R D` @1/ R 1S 1ax@/! 0W4 0 0Xo8X4<dܭ`,HLhĮX8X|ԯ@ZTQ i  0004喼T @<ЍO/@- Q@MH0H9 @/ ]wЍ@/p8p@-QMP@0K $`/T0 L/̋  0S P  H(Ѝp@/ᄶȠ8p@-QMP@0M $`/T0 N/ᕋ ᪊ 0S P GŠЍp@/ᄶd80@-DM@ @0㢇P P G  0bPDЍ0@/E-@2@MPP $\ 2Ÿ/ R]2q/  ᒼ Q@g 1/0 pB PFH^@PS ኼ`PDo H1</ A $P*HBP6 n0`Sw 0/@ PH&P  P P 0 C 0ᨔP 8 @ЍE/tԝ8,9l A-0M,S@P F 1/ RG1a/ Z @ pPDQ H1</  `A PG½@P7 0pSY 0/@ PGᦽP  ួP ᙽP 0 C 0(P 4剽@ЍA/8,9l E-0M+S@P $\ 2Ÿ/ R]2q/ ۺ w@ Pg 1/  pA P+GC@PT o0`SDo H1</@ $PG'P7 S `Rw 0/0@ 0F P  P P  L 0ጓP0 4@ЍE/D(8,9l O-84MP< @\  4d/ R3s/9 [,P !0 0P0H0ՓДŔՐFࠝ X!P0 0P0H0)LL~F@ RP!0 0P0H0$lFP 2R/ `@pp`s0@S 2倂/Td0 @0@u"<Lr"ࠝP@pE@䐍Q@Q$ 2/Td U"<DR"`䠝H0J 0 1@^| 1xQ/ጡ@P Tᄡaࠓࠃ|1 d UhA@X` AXa<`^ @QP"<Z"Lp<V" R"H<@"< HI"D<E" A" d` P!d$ 7"V@(, 0x04E<ѻЍO/Ⱥ8$,ig8 183p@-0MS@` R 1 /P S 0/ RT0/ Ꮋ@P  mEpQ \x0d/ 0@ vP@ P\0Ѝp@/8H<@E-0M S@p  2Ÿ/P  1Q/Q 1a/ ᵸ  `P PY Rd l1\A/0@ P @.(4D,PP `4`2PU 0/ 0@P 0\ @0 0S4 t@ D`0PPTP U:ЍE/ȗd8HH,9,m@-pQPM` 0kP ZP @ᢥ T `0 Q00Ѝ@/ O-0|M/SP  _ x2xŸ/ RX`\2TB/8` pDp@@ὲ@@tP*f 1/p t0d p0t ҭP] _@T|l 1tQ/p ` `IP@o L18Q/t0 Q q 1/Pd-p R% @pp 0S7p 0Pf!P   *C  PW!H0ȠP,h  Ut0[:|ЍO/Ğ8\$p,m|E-@dM'Pp,P `X0 :/ 0Rp;l/㐡 ㍡ B     1dЍE/ሰ88O-0M&S@ \n T2TŸ/P 0o 02(/ Rp2/t tZt 1A/x Ru 1/tx0|@C txPC hPNd cPHZ- A\P` pdBt iB$^ 0S l $NlPp`P+x\* 0/Zt0x  `gtx` .`P0@Ptg O ᎬЍO/8H,9,mG-0hM$S@` \B T1T/P 0C 01(Q/ RD1q/,㦠Xp 㢠W\ QPK 0@/X0\ b@B X\BᾸP`ṸP    "hЍG/l8H,9,mA-0hM#S@` \f T2TŸ/P 0g 02(R/ Rh2r/,>Xp :ዶ\@Qs 1/X0\ bPB X\?BWPQhRPLh@\P | (1/X \A X\B5P/0P*ᖹP%&P ጹPPႹPhP ,@S ;  PyhЍA/T48H,9,mG-0hM!S@P lb d2dŸ/P @c @28b/ Rd 2r/,㔟Xp 㐟E\ Q@n 1/X0\ b`B X\AᬷPSp᧷PNή@\P(w 01 /X \A X\rA኷P1ᅷP,ᛵ\0@S 0/X\@ X\PAhP`cP ᥯   ̪hЍG/<\8H,9,mE-0lMSP b 1/ Rc1A/,`X@ ᣴk4@\ pP*,i 01$Q/X \0d X0\@  PP`, .X\& y'HpX0 S7p 0PbPzP |  @ PPW!H`\ V:lЍE/p8,m,9G-0hMS@` R 1/P S 1Q/ RT1q/,pgX c  ᴴ\ QP8^ @10A/X0\ b@B X\g@P4zP/ Ἦ 4@P\P*h 0/X \d  X\ЩP`UP  ᗮ   ᾩhЍG/᠒8H,9,mE-@dMPp,P `X0 ;/ 0R </ 0Rp=l/ٝ ֝ ዳ S ;  zdЍE/ᬝ8HG-0hMS@` 0J (1(/ RK 1Q/,㣝Xp 㟝TP\ PR 0@/X \b@A X\?ỵP\ᶵP    hЍG/$̒8,9,mG-@hMPa,` pXP1 O/ 0RP/D Aᒳ\ @R0W ࠑ/X\0A t \0XH? `0P    ɨ0hЍG/8G-0MS@p F 1/ RdGh1`Q/\0` Pᛲcd@P*P 0/0 d N8@Q*S 0/ 0d 0$ cP LP  TЍG/ 8,mG-0hMS@` 0f (1(/ Rg 1Q/,|Xp x-ɲP\ Pn 0@/X \b@A X\|>ᔴP\ᏴP Ѭ   hЍG/ 8,9,mG-0MS@p E 1/ RdFh1`Q/\0` P˱ᓬd@P*O 0/0 d ~8@Q*R 0/ 0d 0T ᓧP LP E ᄧЍG/̑48,mE-@dM Pp,P `X0 B/ 0RpCl/㫛 㨛 ] %    LdЍE/᠑8E-@dM Pp,P `X0 8/ 0Rp9l/u r '    dЍE/`H8E-@dMPp,P `X0 8/ 0Rp9l/? <  ṫ   dЍE/ጓt8E-@dMPp,P `X0 8/ 0Rp9l/  Ự ძ k  ᪦dЍE/ḓ8E-@dMPp,P `X0 9/ 0Rp:l/Ӛ К ᅰ M 5  tdЍE/8E-@dMPp,P `X0 8/ 0Rp9l/㝚 㚚 O    >dЍE/(8E-@dMPp,P `X0 8/ 0Rp9l/g d     dЍE/T<8E-@dMPp,P `X0 @/ 0RpAl/1 .  ᫪   ҥdЍE/နh8E-0lMS@ \K T1T/P 0L 01(Q/ RM1a/,``P ᢯j4@d pQ*T 0/`0d d`d ( @<  {P XP D;<P lЍE/ᔔ8İ,mO-0MS@P Xd P3Pß/ R0e43,c/p`⧀  4 ⍙ ㊙`㆙; h@P*q 2Ÿ/0 d <@Q*Tt X2LŸ/ 0d  0 @PzሱPt  Pjpp vPb qP]jpWd h1\a/0pCL 9;`@ P 1/EP1p  ;P'6P"X /P  ݨP$PX PXW @@ЍO/ᴑ̓8,mldȰN@-0,M1SP@` `/ X1X/P 40 41,q/ R 11/ pT ҰP. B0 ({P&0" °PP @0@4l V:P8? L00/ᣰ,Ѝ@/X8H E-0|M.SP` $ 5ş/ R5D/p@ᐮPtP 4ğ/p0t Np tP U tf@h ::RP HMPp[P (*:tP 3ß/tp0A p t1P,Pp  :tPx |3pß/tp0A p tPD Ppp@tP 3Ÿ/pt B pt9PPt0@St x2lŸ/pt @p tޚP0 @ȯP ïP{p Ὥt@\ 1/pt @p t巚Pa᤯P\ ật@PT` d1X/pt [@0BL pt0n9ᆯP>ၯ@P8,P> ; ủ4@t pQ* 0/pt 0d p0t  ϢP TP  A 0yP4E|ЍE/ᰛ؞8|,m,9dl E-0lM-S@`  3ß/P 3ß/,ݖ ږ Q ` PXၬ3\p@W 3 ß/X \cp0A (X\08P\P\ 2Ÿ/X \0A (xX\08ʮP\@\  (2Ÿ/X \0A (X\08ᬮPnUVԾDᠮPM aX P[\\h p1`/X\0 0C4 X PE\Q 1/X \0 0C,@X⴦   ۡP P&4@\P* 0/X0\ 0dX \0\ R JP XN 0xP,;lЍE/p8P A-0 M)S@p` 0> (2(Ÿ/☫{@2PC 1Q/0 L PQE 1A/@@ 0h7PJ R*$H ,1/U2 0 ԭP5 ϭP0 0N P xP#P*Q 0/ e00 `ᩭP Q DᡭPP ЍA/ሕP8$,l ,mE-0|MSP` $ 5ş/ R5D/h@ያPlP 4ğ/h0l Nh lP U or@h 57MP HHPh]P  %7lP 3ß/lh0A h l,P'Ph 7lPx |3pß/lh0A h l PDPhp@lP 3Ÿ/hl B hl6PPߪl0@St x2lŸ/hl @h lٗP0 <ìP ᾬP{h Ḫl@\ 1/hl @h l岗Pa៬P\ ᵪl@PT` d1X/hl ]@0BH hl0i6ၬP>|@P80Pp85 ᵤ8@lQ* 0/hl 0d h0l ʟP OP  A 0vP0@|ЍE/,8,9,mdl G-0M0S`P P 2Ÿ/ RQ2B/pᒩ. PtW x2lŸ/ pA@T @ 5@P,P| 5 0S^ 1/  @ ګPaիP\ 5 0S\e `1T/  @ 幫P@9  S>  ᮫P5 ᩫP0N 0uP(0 # ᖫP  ᎫP |ᆫP    4@ 8^5v@ЍG/ 8,9,mlN@G-0MS`P P 2Ÿ/ RQ2B/pƨb PtW x2lŸ/ pA@T @ 5.@P,)P| 5 0S^ 1/  @ Pa P\ 4 0S\e `1T/  @ P@9  S>  P5 ݪP0N 03uP(0 # ʪP  ªP |ẪP  1  3@ 84᪪@ЍG/ᘖ8,9,mlN@A-0M%S@` M 2Ÿ/ RN1Q/  ᗨ@ pPX 1/P0 C!@PPRhbPL x@pT(` ,1 /  @@ P-4EP/0P)Qh 0/ C@ (P #P  L 0ytP 4PЍA/d8,ml O-0MS@  5ş/P  5U/ R5e/`8@X P㜑㙑  ?PF8 ĩP@@pQ* 5D/ 0g0pS`@P 4圄/ pP`0@ X0 @p P` 4@ w倀 pP`vu@ 0%4 0D P` G  eP`z@Qx 3pS/0gP@ `儠.3 FP\@^ 3/ 0B 03 )PT 2吢/x0|@  P  Px A 0`sP~ (Pu`V* 1Q/` d 0@S 1|/ gP0N l02 ɨPEߦ@P  1/0A 0[P  2 ᦨP"`Ủ@PT| 0t/ g@0Bh 0o2 ᇨP 0<( r ЍO/8,m@,9Pl`E-0|MS@`  5ş/ Rtx5pU/p 0@ͥP Ꭰ v ᵛpP::P48@tP* 4ğ/tPp0 d pt #tPQ 4xD/pt\@@ `pt1 P t PR 4ğ/pt0@ pt01P t PR 3ß/pt0@ xpt01ЧP t PR  (3ß/tp 0A pt0aP  1ᬧPp t@PT 2Ÿ/pt\@0@ ppt0u1፧Pt U 42Ÿ/0hlP vPp qPkhA 0qPcaP[tZ*p x1hA/t0ppe ptet PR $1A/p t\@@ pt11P+tU 0/U 0hlP P P  hB0 iqP @p|ЍE/ `8,mddPl` E-PPtM@``* X>XΟ/P P (0 ,> Ο/ 0  P  =]/oQ\ < Q Q Q Qr Q Q Q Q Q Q Qd]N Q Q Q  Q QQ QQ Q QQ  *Q !Qa Q@ Q QQL QN%Qi #QV $Q['Qn e:)Qo0Qp -Q^ +QQ ,QS.Q[ /Q]gQ 1Qb cQgQ Q Q0S S SQ @ ;K/X@᫣ yP  R` >  S     b '^]   Rx :t:Hʟ/X@XDPPK Y XE 2PP l\0S PPf\PUX_ j  R <9XI/X@ R` ?L9 ɟ/X@PP6\P3 ᇥPP.U PQ H R /@ ; 6^ . RP988 H/Xʢ@XⵦPPT@ BPPT 0S\C7G/X@ᩢ  E P Q~ n Rv  g^i F  0SWXf뤦<PPTPS 60v/X\@XP L6U/X\ NX \Q  6ş/Xp\P0@XP\0PSp 5lş/\ X0BWX\ 5,ş/t\P 0X%@3.P, 85ğ/ဤPP'T T P!W 4D/ X 4Xğ/<@ -X q-W\ t4ğ/X 0P4C/<@ ,X R- P PP@0#-Pڸ 3`S/#PP\Z*x t3 ß/X\0 g,X \\0S'    b T ^T ^ KPP\PU أPP\x@L H D @ < }PP@lT< tPPdL0S< @<@PD(0! @P-M 3vQ  n ijp ፣`d R:P L1P/d08! -wd0PSUP iPP`L 0yPP X+PtЍE/8lıdȠ@,mX<`Hܠ3Ċرt (4DHX\,9p @- `Pp@MX TT0T/<0(0080, @ 0PpЍ@/X8,mp@- 0P`@MLL0 D/4<0 @0 Ѝp@/X8,mE-M`p+Z00V0S  +P K~@P@@P_~0 / ЍE/t|E- QlM@p\` 8!0 / 0hPP fTP @0 @ @@P ~PlЍE/H8 E-QlM@p\` 8!0 / 03PP 1TP @0 @ @Ϙ@P S~PlЍE/t8 E-QlM@p\` 8!0 / 0PP TP @0 @ @嚘@P ~PlЍE/᠓Է8 E-QlM@p\` 8"0 / 0ɁPP ljKTP @0 @ @e@P }PlЍE/8 E-QlM@p\` 8!0 / 0ᔁPP TP @0 @ @0@P }PlЍE/8 E-QlM@p\` 8!0 / 0_PP ]TP @0 @ @@P }PlЍE/<$8 A-M(` RPP\p,0 0BS#0ꮃ0@姃0@堃|0p p@/ꕃX0D pꍃ< 0/ЍA/tزIJ,<E-M M@Qp |`| +Px4@f 0/ ЍۍE/a\O-&Q|M@`ᠰ夐 $( 2Ÿ/T ) 1Q/hp 0㪀PPll0S|)Pdx0a  ,P/w@T$  0ᑀP%X l )P |@QG!xw ^0 Q  b NP w R5 h 0kP P+p4@eZ0 0@P |P TP  z|@P0S L|ЍO/L8 aO-!QlM@`ᐰ唐 $ 1/T % 1A/\p 0@P]`QP MP' 0P `P ?P 0P`P!|)@8 ,P 0P @+ 8Pه]Z0 0xPP {@ ȈP  {@@0S lЍO/<8 aO-QlM`Pᐐ唰 L$ D1D/\  0@P@`P: {)@8 P  0{P @+ p8uU0P 0PP  {@ dP   {8@0S \lЍO/$8 aO-QlM`Pᐐ唰 L$ D1D/\  0,@P@`P: [{)@8 fP  0P @+ p8U0P 0岕PP  6{@ P   ({8@0S lЍO/ĸ8 aO-QlM`ᐰ # 1/X0\  0~ pPP8@)ÆG@ 0@d@P  zP0y030 1P    z4P\YlЍO/p8 aO-QlM`ᐰ # 1/\  0x~ pPP8@)sX @ 0 @@P  zP P    z4P0SZYlЍO/̑8 aO- QlM`@ᐐ ! 1/\  0(~PP/ 8p$T0@ @ 0@”@P  FzP[ 0 SP   5z8P0S lЍO/ᄑ8 aO-QlM`@ᐐ嘰 " 0/\  0}PP+ p8ӅWT0@ @ 0@q@P  yP P   y4P[ lЍO/h88 aO-QlM@`Pᐐ嘰 l# d1d/T D$ D1 p8{U0P P 0PPP  y@% 0 ShP   y@[ a\@ $}P `P:zy)@@lЍO/ᔔ8 aO-QM p8 h2hŸ/@ 0 }PP:Oy)ZP 0 }P t0 @/ 6.PC&@ R.P㟠B1&PY  &PS @TyXNPUY X xpxP@`^@ 0/8Pd@`ƄJ[0 0d@P x0 ᳅P  xT Y    ЍO/ظ8ft aO-QlMpᐰ $ 1/Y1X 0p|PP^`4@l@ 0@ @P' Z Z ]لP0S WZ X0>|P\P XfxPP_xPPX`0 |0Pdȓ@PdPXlЍO/ᴑ8 aG-M0MQ@ᔐ - 2Ÿ/}p 0{PPr j 8`lT1@  J0冒@PxPT)PR0$@*$p =0{PB\ R1` (%ʍh `R 0Sʍ mM`.Ɲ@T :A (~RZpW!1*x 0 0S! ͍wZP0 PB$B ! PpЍڍG/p8 E-MM` Q*@d 2 |3|ß/T \3 \3TC/$ 0L{@P:0 zcg0@-(@S#Pd@/@G-M@  f0PS` : 0CSp1p#$T@ p U, p@' PU% p B,$TPE`\T@ W @pG@PU*T  b0L0kfЍG/A-cQMP,  0/p` 0z@P0SS@Pp -v)vW@ЍA/᨜8O-#QlM@`ᔰ # 1/T $ 1A/\ 0y@P_`QP P> 0yP7`Pu)@H P+ 0yP$p 7PP3 0yP +PP' 0yP  PP 0yP @ 8P |YT0 0PP u@lЍO/Tt8 E-QM4 " x0x/p` 0HyPPp  @P tuPWЍE/`е8E-QM`4 ! 0/p 0yPP @P 0yPP0SS >u @P 5uPЍE/< 8A-QM` " 0/P 0x@P" pWPu@ u)@n" 0P  Up,ZPP t@ЍA/X 8A-QMP,  0/p` 0x@P0SS.@Pp ttW@ЍA/ᐗ48E- QM4 ( x0x/p` 0pxPPp  @P tPWЍE/@H8A-QM@Pp@, % 1/U & 1Q/0  :xPP `Z RS00S'xPXP "PL0 B`0@.T0 B0 6!   p!@ P dp t X@ l `P hmr@,tObxP%t ob`4@hp#~Zx0 0Œ@P Fr !a@@ЍE/p8P E-Q|M@ᜀ ) 2Ÿ/\` 0uPtpPpPPP p` AP!!-*p0S W P\p0 uP~w`PPo DPr0 uPk`0Sq)c w0.P\0 uPU`1PP0 uPI`h"PP;h P?0 yuP8`lPP*lP.0 huP'`P"0 \uP `8PX}Z\0 0PP {q U`|ЍE/(8 G-0QM`4 D( <1</  0$u@P > PP$ ^P2  0uP+p 4PP  㖔P  0tPp /PP  *q@  ~P9 S   _@ЍG/ ħ8G-QM`4 D( <1</  0t@P > ᐏPP$ P2  0tP+p ؏PP  :P  0tPp ӏPP  p@  "P9 S   _@ЍG/ᘖ8O-=\M$@`T舰 5 =}/@DpW@0@ U@VT[t@POHZQP 0PtPCHP(3P @  ,P @ P  P P*;X-Z^X00 S$ 0$tPHPxP @v \P @@p  xP0 R.R ;PX.R? 0:P P Q P yP@ 0"T  @ TP@P dPP QPU[ oPoH@U(;0@ +/ DPR00 S% sPH@P   P *00DP 0sPH^0 sPH@<sP  lP P Pp\;PPW00 S esPXH@HPq tAPh  P0 R.R;P.R?0;@P@@P0 S P P@ "T   @TP@P P P0 SPU[ nPnH@U@80@ 00(/ DPR00 Sk rPH@P   PsD@ 0rPPH EPQ.Q mQ"aKX*>S#.QP @P m\\  P EP X@`T @TPm\0P0P@0S&X[P6DPX_[^  0rPD@ATeP HPp R.R mR aş W.RPPP@P0 m^^ P P@I T% @TPmP0P0P@0S6W @$0WT  @X!4 U  D@€0W&rPDNPTnP HPp R.R mR_\DWb.RP0PP0@P mQQ P P@ T% @TP@0mS0P0P0SW@ $WR@@X 4q U g D@€0VqPD0CPP H"Pp R.R mR BWDm)@.RPPP@P mQQ P P@| T% @TP@m^0P0P0 RiW@ $WR@@X!4 0 U0 02U0T POW PIV PCU ېP=@T 41 ,! ,! b@lѾP$0S  .A  @`0n帾P DImt@aKd*>⓱ 媾@\ЍO/x`88 tIJ8(\`yՍJ]`6E-%QMP4 @# 818/  0p@P p= `P   m@2 P,  0pP%P: l)@ P0  pP`@P  l   5P  [ @ЍE/$8O-*Q,M@pT & 2Ÿ/T ' 2B/ 0xp@P0S` !Q[`   :RP V Zh*/>`P VlBy' @PPZZ Z7@  g/PQ' \X@T@,0S@(P@$ R@ P   J/P9'^; (0$@ST B@ r@Dl@2 @ MP'' P" ݎP ∏Pv %l@ l`@lP@ l)@@l,ЍO/Ċ8E-gQ,ML` H @3@ß/@0 @@ @@@o@Ph 0xQf zQPP @P @P @P @P BrP ^0d00 ^  1 d0 0*!0PdP.  َ@Pt ӎ@Pn ͎@Ph ǎ@Pb@@[ 1A/0 @ Rp 0@o@PF0c[0 4o@P:$P $\(0 #o@P) $0`P0 o@P w$ R Z0V PD@@@ @T,ЍE/г8G-QpMP`ᔐ ( 2Ÿ/\p 0n@P 8vUV02 ` 0p`P j@w 0nPo` QPj 0nPc` EP^ 0nPW`xaP PO0 nPHnމP h` h0S jA7P' P+\@0 jnP#``P P ` sYP0 UnP`Pj)@ P ` [Y @pЍG/ 8 G-QpMP`ᔐ & 3ß/U ' 2R/\  0nPP @8pvV2` 0崄`P  8jP  0mP`h 㴰`hp0S  "jR{!0@V(" 'Pp |Pk  0mPd`AP@ P\  0mPU`P2 PN ` XPH  0mPA`P P:0  mP3nP `h hP\  iP"P  P\@0 mP`P:i)P P ` X PpЍG/8Զ @-M`pLiP V i80P@@P$i 0/Ѝ@/tܳ-@-4@ M0 0  Ѝ@ Ѝ/9@-0MS@`p O 1/P  0P/ R0/PG@uᆅ ~P@Q*Ld `0D/ 0d  uЍ@/8=>EA-@MPp`ᰀP0 K/ 0R/8Gst8 ~P0@TS\ X0D551/1 0d 0(ЍA/` 8-7A-@M/Pp`PⰀ0 / 0R/Fpt% @0Rl d551/10d 0<~0P ݋0ЍA/Ğ8A-0M.S@` HH D1D/ R ,,1 q/pF݉ 㯋P2P 0@/0P C tኄ@Q*`M p0\/d }P z ЍA/ᰛ؞8-E-0M&S@p d \1\/P 8 810Q/ R1 a/㰠3F n@T 0/ nP 1`P0S*x 0p/T 0 @`e`s   j}`ЍE/8H@-0M$S@pP s 1/P t 0`/ Ru0/`E ֊PQhz p0`@/0@ C 1s᱃ }Ѝ@/l8HA-0M#S@p` P H2HŸ/P $ $2/ R2/㰀sEᮈ 《PiQ 1/0@0  iPR@@Q*8 @10/0d0  OP8@@Q* 0/0d0  5PP@PQ*h p0`/0@ e r  m|ЍA/T48HA-@M!Pp`ᰀP0 / 0R/D P x0Rd \ࠑ/0A0DrĂ $|ЍA/\<8A-@MPp`PⰀ0 / 0R/Drʇᒂ @0Rl d551/10d 0{0P 傉0ЍA/ጒp8E-0MS@p`  1/P h h1`/ R@H1</㰀n~4AdP* 1/`!dd `d xPP) ~Ad1S* 0/`dd  `dwPP VR\!RP`X K;R[ߍE/ᴑ̓8A-@MPpP`Ⰰ0 \/ p0R`]\/J@mႃJ~ wЍA/8A-@MPpP`Ⰰ0 [/ p0R`\\/@mQ~ ywЍA/(8A-@MPpP`Ⰰ0 [/ p0R`\\/?km } HwЍA/T<8A-@MPpP`Ⰰ0 c/ p0R`d\/?:m} wЍA/နh8A-0MSPp H @1@/P  1A/ R0`/`{?@lᲂz}@Q* 0/ 0d v@P PP@ &QЍA/ᔔ8A-`PMp  9ɟ/ 0  t | x9lI/ @ Q@K 8 H D90ɟ/ R6 ; R R R Rp RR R R R R R RR R  R RR RR R RR *Rs !R. R R RR R%R6 #R# $R('R< 3:)RW0Rr -R_ +RQ ,RS.R] /R_gR{ 1Re cRkR{ (7R Rp@T T T@T h 6Ɵ/P P:L  B R?@@7 d 1_ R/'\1 R` #N 0S%%,*J > R c6 Rl$1@/C $N P@3": 00 Q:P 0H/=P@@ЍA/8XıdȠȗ@X<`Hܠy8Dp Xt@-QDM@`P\p T L2LŸ/T , ,2$B/ @L=j X0pwPr8P O<0Sj8 ㏁Pe<P 1/8<0 C8 <\O<QM<<@\G:8 lPB<Q* 1/8<0d8<9O< R*8 OP%<Q 0/8<0C8<O< R <@Q:O 8)DЍ@/8Զ'@-QDM`P\p  1/ @<xi X0pfvPU8PoN<0 SM8 PH< P$ 1/8<0 C 8  W%W #W $Wx'W :)Wr0W! -W  +WK ,Wg.W /Wb gW+ 1W cWZW0 :W6 WR#Z Z ZK0 ǻ|0  u0  肻n0  g0  `0  `Y0  8R0  K0  D0  =0  n60  (/Z`$G X9Fd R(R)\^ :`Xd dTFd0  % ᙵ@P60  0   ᅵ@P R 0  m0  -XF\@TG e@P0 S  \0  ZXF\ R X @y@P\ Z|0  0  KZl0   '@PXj ZYXF `E\Pd^pX `F `@qFd Rx `Q@[RqQ  \m!2 SjSh Q 0 Sb!2 S_S] Q  ^W!2 STSR 0B`0dxwtşt% QGdP\& T5(ş/` d0@`d0`w$$%Q/ FF`  0  5Z0  Z0  Z0 $ Q`EdQ]F`d Z0 & 0  `ES`d @`@"wd@Qu 3xßࠑ/d` @0Rd`0d :`dd0`S CE XD\@T: `XF DyZi0  N0  0  0  kX|E\Q?ZDXsE\Qz 6 @P\  RB XbE\'0  ^Z$0  UXLE\ RSX00SRMS#RH0$0\0\EX\ w7 `T   HE0@S-Q@+ e  h0hlu@@4 P 00 P@ @)@T@tЍO/[8X O&d?M E-pQLM@PhI kvPE 08 DWP<0S)P#:*D< HGPP4D< NPP*D@< RP$qvP(`  2 D 0 `MP2C DGPDFPLЍE/LFO-!MMʍ@ATp`DL _P T L?L_/^ 0  $ ?/ P1S  R>Ο/P RB>^/:=< P0 倠.$ 0͍4  0!WPP R@R*P0 P'%PJH1 0P 6SW < WF W  W Wt WW W W W W  W\]u WWg WC  W* W2WF WNWx W_ WgW y*W !W] W W W W< WD%W #WW $Wa'W :)W0W -W$ +W ,W.W' /W/gW 1W cWW W WxPX* X3 Xo,  0oVPP! @:0 P1P Rd[! yBʍQR B ʍPQ0 PP-  0=VPP!L@\ P1P dRZ !FBZ u eB ʍPQ0 P%P P0 PZP 0PA @OP ʍPQ0 PP P0 YPx 0PA @Pm ʍPQ0 PPb P0 DPWX 0PA  @FPJ ʍPQ0 PkP? P0 P4 0PA @P) ʍPQ0 PTP P0 P 0PA @P ʍPQ0 P%P P0 fP 0PA @P ʍPQ0 PPX< P0 PX/=(  0/UPPʍ-,P*]⮰T|6 @, 0kPP LQ 0PA @P P0 $PXX,A  0TPP0P0: "Q)P -PP|0  TPPuʍ,\-`TD5]@ , 0ykPP P\0  TPPUZ,\=@T4@,  0YkPP@ P< 0PA @>P1X0  TPP&X,@L*  P PS !@ʍPu @  ZP0 P 0PA @WPXS ʍP0  PXF ZP0 ZPX9  09TPP:P: gP)P rPP0  %TPP͍ ,P \⤯TT2*@, 0jPP BP 0PA @PX P0& (P  0SPPʍ-,P[jTl1@:, 0jPPk PgX 0PA @-PZ P0 PO 8@ 0SPPFPO)P= rPP90 SPP2ZPO)P)48GXJKTC #  \rPP  JP 0 JP P P0 P=,  0WSPP ,PR[֮T0*@, 0iPP tOX,A*/M ,@00S!̍PP⬠ZHuPPx!!@Q 0P# LO &! 0C, N\@T: qPP@ qPPX ,B  rPP Z 0 JPQ PPxX  =Pp P0 Pe ʍP0 PZ0 JPQ PPOX P0 sPB= @ 0RPP9P:N)P0 ݦPP,0 RPP%*PN)P cqPP0 |RPPPN)P OqPP  IP N8N@ 4 OʍP 0P U PP")NʍN\ @U PT ͍4PU\ :P0M4@ @P^*P ^UQ $0 @  !Lb0J  oU# : $< ͍< Z 0  P$PP@GߍڍO/@- 0MR@Pp ` 0/ Qx0lh/ )^T0D@/vo so Ѝ@/Ĵ8p@- 0MR@`  0/Q  0P/%^  0/ Rp|0lP/ RL\0H/P+o (o  @Ѝp@/Ĵ80Dp@- 0MR@`  0/Q  0P/^  0/ Rp0pP/ RLll0L/Pn n  @BЍp@/ᘚĴ8X0Dp@- 0MR@` 0z (1(/Q { 1P/^ | 0/0S } 0P/ R |~ 0t/P P `0HP/P|n yn  @~Ѝp@/HĴ8lp@- 0MR@` h 0/Q i 0P/^ j 0/ Rpk|0lP/ RLl\0H/P-n *n  @~Ѝp@/`Ĵ8ȵ0Dp@- 0MR@`  0/Q  0P/^  0/ Rp|0lP/ RL\0H/Pm m  @D~Ѝp@/ᘖĴ8ܵ0Dp@- 0MR@`  1/Q  0P/^  0/0S  0P/ Rp0l/ RL`0HP/Pm m  @}Ѝp@/Ĵ80Dp@- 0MR@` i 0/Q j 0P/^ k 0/ Rpl|0lP/ RLm\0H/P7m 4m  @}Ѝp@/<Ĵ80Dp@- 0MR@` b 0/Q c 0P/^ d 0/ Rpe|0lP/ RLf\0H/Pl l  @N}Ѝp@/XĴ80D@- 0MR@Pp ` 0t/ Qx0luh/ ^T0Dv@/l l }Ѝ@/Ĵ8,p@- 0MR@` ` 0/Q a 0P/ ^ b 0/ Rpc|0lP/ RLd\0H/Pdl al  @|Ѝp@/@Ĵ8@0Dp@- 0MR@`  1/Q  0P/ ^  0/0S  0P/ Rp0l/ RL`0HP/P l l  @p|Ѝp@/ȗĴ8T0D@- 0MR@Pp ` 0S/ Qx0lTh/ ^T0DU@/k k 6|Ѝ@/Ĵ8hp@- 0MR@` 0y (1(/Q z 1P/^ { 0/0S | 0P/ R |} 0t/P P~ `0HP/Pvk sk  @{Ѝp@/dĴ8|@- 0lMR@P  1/Q  1a/pW  1/^ tU 1pa/ RLll1Lq/ R(PP1(/`pX`k,Pk\U YUe e WP @&4@dPU* 0/d`P\ d0Q`0d *H t0D/X\ 0eX \0J{lЍ@/QĴ8RS̶U0VDab@- 0lMR@P Q 1/Q  1a/pW t 1l/ RLdd1Ha/ R(RD1$q/`pX`j,PjT TKe He XWP @&4@dPU* 0/d `P\d0Q`0d*Ht h0@/X\0 eX \zlЍ@/ Ĵ8EFG0DUVA- 0hMR` ,o $1$/Q p 0@/P'U q 0p/ Rr0/ Rs0@/,@KT`p GTX`iid d  PVhЍA/8Ĵ80DA- 0hMR` < 414/Q  1A/PU  0p/ R0/ R0@/,@S`p SX`iidd ad qVP Py hЍA/pĴ8 0DG- 0hMRP`  2Ÿ/Q  2B/ẐY  2吢/ RlR2lŸ/ RHhh2HB/` XFi Cid^( $2/\0S 2A/ \ d y@Pb,iS fS i id pPP 1L/` d0\@CT`d L @1/X\@@ \X@c c U@P'4@dPU* 0/d`P\ d0P`0d *P 0L@/X\0 e X \/y@hЍG/EĴ8FG 0IDN4ODZ[bcA- 0hMR` Xs P1P/Q (t (1 A/PU u 1p/^ v 0/ Rw0@/ Rx0P/,@R`p RX`ZhWhc c  P+UhЍA/ἙĴ8T0DG- 0hMR@P  2Ÿ/Q  1a/pW  1夁/ R1/ R`p1\/,pMR` IRX g g b b T`P 34@dPU* 0/d `P\d0Q`0d* 0x/\0Xe X \R R b b T`hЍG/Ĵ8h0DG- 0hMR@P  2Ÿ/Q  1a/pW  1夁/ R1/ R`p1\/,pQ` QX ig fg .b +b ;T`P 34@dPU* 0/d `P\d0Q`0d* 0x/\0Xe X \{Q xQ a a T`hЍG/̑Ĵ8|0DA- 0hMR` ,x $1$/Q y 0@/P U z 0p/ R{0/ R|0@/,@%Q`p !QX`ffa a  PShЍA/ᄑĴ80DA- 0hMR` ,n $1$/Q o 0@/P U p 0p/ Rq0/ Rr0@/,@P`p PX`yfvf>a ;a  PJShЍA/HĴ80DA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@mP`p iPX`ff` `  PRhЍA/tĴ80DA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@P`p  PX`ee` `  PRhЍA/᠓Ĵ8̷0DG- 0hMR@P  2Ÿ/Q | |2tb/pW P T2H/ R(42$/ R2/,pO` OX ee be *` '` 7R`P \4@dPU*l 1d/d `P\d0Q`0d*$D 81/\0Xe X \wO tO _ _ R`P'4@d`V* 0P/d `P\0dS`d*P d0H`/X\e  X\fu`hЍG/ᴑĴ80DA- 0hMR` ,o $1$/Q p 0@/PU q 0p/ Rr0/ Rs0@/,@N`p NX`ddj_ g_  PvQhЍA/Ĵ80DA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@N`p NX`IdFd_  _  PQhЍA/Ĵ80DA- 0hMR` ,n $1$/Q o 0@/PU p 0p/ Rq0/ Rr0@/,@=N`p 9NX`cc^ ^  PPhЍA/<Ĵ80DA- 0hMR` ,v $1$/Q w 0@/PU x 0p/ Ry0/ Rz0@/,@M`p MX`ccV^ S^  PbPhЍA/hĴ800D0@- 0lMR@P  2Ÿ/Q  2Ÿ/&^ ` d2XŸ/0S 4 <2,Ÿ/ R 2Ÿ/ R1/`3cX0cdP`@X UP@ 1/` d0\C\`dT h1L/UX\ D:EAdB@\X) ` P67U6 dPU* 0/`d0\ d^` d* 0P/X \0dX\,@M M`] X]  POlЍ0@/Ĵ8D0D  A- 0hMRP`  1/Q  1A/$^  1/0S | 1tA/ RTd1P/ R0D1,A/ r@P :,L `@LXP]bZbd pR 0/` d\0NS`d` t0X/X\ @X \\ \  OhЍA/lĴ8X0Dp@- 0hMR@P 8 040ğ/Q  4ğ/#^  3ß/0S  3ß/ R3ß/ Rd||3`ß/`aXa`X Pd@T C $3ß/`0d\ A^` d 2B/X \@`\X@ T1 P]d@Q*\ t2TŸ/`ddX@`d \0@S* 8 $2Ÿ/X \d`\X0@T01 ~P.d`@V* 1/``d dX@` d0\@Q*P h1H/X\ d`\ X0@T01 O`P 97dP@U*  0/`Pd dX@` d0\@Q* 0/\ X,P0dX0\dK aK`[ X[  @MhЍp@/TĴ8l0D !*+A- 0hMRP`  1/Q  1A/!^  1/0S | 1tA/ RTd1P/ R0D1,A/ @P :,J `@JXP``d pR 0/` d\0NS`d` t0X/X\ @X \C[ @[ PMhЍA/<Ĵ80DG- 0hMRP`  2Ÿ/Q  2B/^ d h2\Ÿ/0S 8 @20B/ R 2 Ÿ/ R2A/ "@P i,]J` YJX  `  `d pR` t1X/` d\0NS`d 01/X\ @ X \Z Z LP,4@dPU* 0/d `P\d0Q`0d*` t0X/X\0 e X \Z }Z LhЍG/᠒Ĵ80DA- 0hMRP`  1/Q  1A/^ | 1t/ RT`1PA/ R0@1,/ j@P :,I `@IXPU_R_d0 pS 0/`0d\ A^` d` p0X/X\ @X \Y Y LhЍA/$Ĵ80DA- 0hMRP`  1/Q  1A/^ | 1t/ RT`1PA/ R0@1,/ @P :,I `@IXP^^d0 pS 0/`0d\ A^` d` p0X/X\ @X \oY lY |KhЍA/Ĵ80DA- 0hMRP`  1/Q  1A/^ | 1t/ RT`1PA/ R0@1,/ Z@P :,H `@HXPE^B^d0 pS 0/`0d\ A^` d` p0X/X\ @X \X X JhЍA/Ĵ8и0D0@- 0MR@P $v 1/Q w 0/^ x 0/0S y 0/ R pz |0h/P D{ T0</ P Ѝ0@/ȠĴ8|E- 0lMR`p  2Ÿ/Q  1A/PU  1嬁/ḠZ  1/ R`p1\A/ R<P18Q/, G`P GX@`]]] %X "X4@d ^* 0/d`P\ d0Q`0d *p 0h/X\ 0e  X \0 JP -P lЍE/ᔔĴ8|0Dp@-@PM` 8ȟ/Vh l8dȟ/ R@PP8@ȟ/ R448ȟ/ 0   8ǟ/   U 7ǟ/ Q 0R #*R ; R R R Rp R8R R3 R R R+ R R&R R  R RR RR R RR *R !R R R RR R%R #R $R'R :)R0R2 -R +R ,R.R  /RgR 1R. cRR? RB R5Q Q QTP3LdHD@D<8 40`,!(Q"kZq( |IQcQ]6XQOldQEQ7Q1Q+BQ!*`Q R2R/ R2tŸ/ @[[ P k R`P2 R/ R<i m^$$ 2/P2  R1Q/ RNF R1\/ R  RP1 Q/ Rd) -Q RHp 1/ R$r K$Q R0xP/ R0P/PZ Z @ uЍp@/O88PQhRSĹD0DpEF Xt'P 0@ S)P /+P .0@ PS /+@P@8 /39/+P/@P/)P P//0  00000 0 /0@-QP@PM  ,_(0(/$00Ѝ0@/ᘻ8/0$ R( /(0S  0S(0 /@-@0(0@/$0 00S/p@-`@$ !1R1/S@ .S/P Q^TPP 0 S0!S0!08`00p@/G-q8@ 0P/KP$ ` 1S1/S` .S/PP RUVpp  `0,3{b0 nJN0@P P㑞.P J>^,0   %/,0 ,P00`,`00M. S  `vdMN D @0 8 ^ 0/0/@/x,iSND80@-PP@M 0K ^ /TL 0t x ^ d/PM< H08/0 /Ѝ0@/,xiSND8pbRSND<S 01 0P1000:0ʀ0RH  /@-@Pdd `0 X ^ P/,0 S(440(/,@/,!seR8-\@-@P88 40 , ^ $/4@/l!seR8@-@P88 40 , ^ $/8@/l!seR8@-@P88 40 , ^ $/<@/l!seR8@-@P88 40 , ^ $/@/l!seR8@-@P88 40 , ^ $/$@/l!seR8@-@P4 00 ( ^ /L@/l!seR80@-PP@M< 808 0 ^ (/L@Ѝ0@/l!seR80@-PP@M< 808 0 ^ (/EЍ0@/l5!seR8@-@P88 40 , ^ $/@/;l!seR8@-@P88 40 , ^ $/p@/l!seR80@-PP@M< 808 0 ^ (/p@Ѝ0@/l!seR8@-@P88 40 , ^ $/0@/&l!seR8-0$ M0OK Ѝ/DE-PPKMp 4R  4ğ/,P x 4tD/WPd `4L/0 (DD4(ğ/00 - 8^ 4C/@8%$PrP  3ß/#3cNP`Q07 <X,d `3(C/ @<#PrrP $ 3Ÿ/a"31NP@ 2 02J@ `aQ`@;0 "! AC $ 400PH$100 J 0 Ÿ!)E 4$ 0P)$10@VJ0`Z  n$ [{PFO ᫴ `!t% 0 ǂxX@p-0S@ ^*T!@!x03J Q@0S*T!@!0JKߍE/!seR8\8X@d1p@-@PP`0  t ^ l/L0SPP 0#,0LS88 hPd`0P"p@/l!seR8@-@PMP`p 0R  0/P\d "U00Vh00Wd00 0BS0(( "Ѝ@/!seRl80@-@ PM0S 00HHH 0P " 0,C\(( P "Ѝ0@/ @pp@-JM$PU$  43R  (((3(ß/0 3c/$"0Q"j"`@P0 L0R "[" 0S0t"S"0 M"P @l h2<Ÿ/0 0(<"P 0 $2/ BQ")"0 !:@ CϠ0I0 4$ 0.P @*`!0#<0 ! d)E?0 4$ (0m.P 1@` 0; Q !$P A4)$10 Q A *) 0AS0tP !Jߍp@/!seR486;?KO$cTV(@Db0@-MPP@ ||0 x p ^ h/` \0  D40PP 0 Ѝ0@/l!seR8p@-@P`Px0xx  l ^ d/``0P P00U, ` ᯎp@/l!seR8>$%@-@PDD @0 8 ^ 0/`0`S㬆@/l!seR8@-@PDD @0 8 ^ 0/\0\S㒆@/Jl!seR8-MC=Ѝ/p@-M`PP@0  ^ /\ ^0 尊d0!PP  0 QR0<Ѝp@/l!seR8E-PM@P  p1R ddd1d/U)L\P< \0GPB\ cPP9 `奡$@TP` 0V( 0tJpP%  BTP  U E` $p P0F  U 00E` $p0\ LЍE/!seR`l8)vE-`P Mp \1R TT P1P/,P (4 01$A/x3W  !R1P/ 0J@PP) WP | 5ᰣp6 S?PP 00 L0F T P@TP@P T@ ЍE/!seRl8)A-PPM D6R << 868Ɵ/DPP  6F/Q  5e/qW  5尅/$^  5ş/01S \ 5XE/!R 0` \5,e/TP < 85u/tQ  5Ԅ/%$5@@ğ0$@ +9p^0<`0H P P 4Lğ/H 0 @T00 HQ L L4샟/H 0 @XA```0x`Vt0t0 \Q  3ß/t\t Rx0x0 X1S < 38ß/xX0x0t0H || 2E@T`A0x`Vt0t0 d\ ( $3Ÿ/tdt^x0x0 `Q h 2dŸ/x `!xtH20| 2RE@ThA0x`Vt0t0 l\ d `2/t l!t^x0x0 h1S  2/xh0x0t0H | D1E@T '|F!4`E48PH` =` PH =_G KH@ @1gD@@H04,|0D P d! B0@\0 8 H0P |3ЍA/!!!F 8 T  8    X`0'.0?`Ѝp@/Fh8J@-PMP`CPp|@xßP@l0h# 2d0 L D3Dß/ Td@U@0d0 T Q 2Ÿ/0  P  0T;@P | d^x@dQ`AtPxdA`@ @PP0<H `&&|"2;@P | l^x@lQhAtPxlA`@!M000 (QPPP``u@Q QP0Uk 1PPePPaB. DeP a\+0X FPP;` qo΍ PP  D'` qN0@P$`: P 1P`ƛPPh h 0@ 0 +'Hǝ\=DP JB. ߍۍO/CpA? / @U.,@ #QH5T,8PPEG+>1@ (>K~@pOn@ `;6 ? %]d @C>,Al@ 0 Pp `j'WߍۍO/.8ȟ 7U/8@!<@: S<1S9tQU6<H 0P!T^@f@H 0AS0 -kT .$b Z"R$Ѝ@/!!!F;8X(( dP80T1TQU $8PP0P@ 0(( >@PPH 0 &PP H  PP H P PP8< kPH D6ş/HE/4 0PPnQHPF  PPb"M@ pA=P S<0%MC aQHş 0 `  0y]P :<X0T%4|Q(_,Q(@H$%P PH@ 0S``H P@PH  ` `V `$ `@PVP `2 $-"P4 4PH  08P 8~H< H@ 4D#$@H0 ,3$U3HS@CD#08^ @@H.S`"Π8x# `PRP9\ß?0#HP#<@t@Dȝ8@†, , @ FDQ ^$``$P(P` 0R(``$(0`TRT, PX& U"X,0X0'PȝL2P 0(P8P P$ 1(H0 ;RQ H N\!&U,1!0@0 2,8p, \0#ꐀhPYH P, 0#PЍۍO/!seR8<RSNDH,rH[ @`0@,@h   <040 `@+ 0<``P  4 - ` P, {W=,-%>@P P  v0 8\ `<L{@!\h|(̝, 0@ PP8P^ |`Z  hPU @&8 ,RK΍ @:  P0p03UPPU@6h.hH+;$P,P(0#@0@ QD˟. 00  @? #J ˟p+p0P@uZ :P3! (SP?P X  :Tʟ/ 4 R  <lJa<` 0^P F P B RMP0 8 + <P@p+Np&n + ` ? vIǟ0'0  `f \L@3@p Pa PV7F&0@OV̝  `(6P p|P0S P! CTT .  `P X0P $PL!D, R00SH\D^@+.R D!RppWHH0!R00S D 0R.R /R !΍ pP N @n ` PpP   `R9@L`T 0 \p1piX[ \ 1Xp/PTP l0\R!!!Q8!!!F  \pP>N. @ 0  OpP1΍^` 0P@N`,D "]lPE0 `xn,2`%  Y0 p i8WP WP@.SO'[L P@CP`P@0P,Pa P t P8 `$0,`>  ,0  $P ` PUp P V  L ,P`  `d6V#@@ ,`@@̝'0@ h ppp,,,PU L P7PW/([ (@p4 D$P<S( \Q0P<P8輝 @L[ 9伍 ̝$0 0SRP PsT @3P@@<  HP`p `a<H`,0S0t(NP P` @TP` pHP1@`8^ 0P0, R` [ @ T  0^N )͍ P.N @  t/ [ <Pp0)m 0A `( < Ck[0j+@40+  T` [W  v @ ^ @0X,@L,0 @Z(<͊oO0  @````0 xP  <H@ 0S0H ``-T T H<!0CP -  P [[ W꼽 =DLPUQH0p#RppW `L` @` ~$` 00PNPN@`N@ 0>^ 0P 0 Ꜿ@.0 >.@.0  AߍۍO/O-M4 4,R  4ğ/4`V dQ HX T4DD/@T`08D@400$0 4C(%&R@-@\,@/p@-0M P` 6 P  o R @  Ѝp@/O- @GM M`pUP PP (PPEF+MAn@ `-  RzP G΍T[ p0ll^0B`` 0TT 0 P`|ЍۍO/0<3D$c pGTǝ 0P `%P 0@(('(ǟ 0Tǝ 0 `p P @&Ɵ 0$@ Ks> n~gP EP(ud&j. &P(p +,Ɵ$ ` &0 p`r.c>P_T @, [ 0P@` p`P@ 0 p ``T90PPP W To~P0  q mPr_n@`Uc΍P < _>8 PoN0 U Q@crP`T T@$PP o` 0 95p_^r΍P@W _n)Pcp"Po>@P(` 0p@ `@*p 0 `@@W=0#PPVPo 0 RP_rN`@Uc΍P _>oP 0 4@r.cnP`T W0Ÿ PP o  0r^_@^P _N@᣿Pjc>@᜿Pcsn gP` P4j g# zDP0!8gP+ ] $  0 f@js~n^ pPT `( gNWPj @PPߍۍO/D8H]]30< VTFp$@T  P00H0l0@0H@ R PPH DQ R:^>A΍ E PP DߍۍA/ A-pPM`P 2Ÿ/0S  2B/V\p l2XŸ/U4P L20B/@!P$$"[WX"P"Qt!P!G00. vMPP:"PT \X 8P *"PD ``!"? HDP 0Q*"P$!}!P   L"P  P\h 0d/ P0 P !P(l  ЍA/$8<|\Th `E-@M`P BAA) 7ǟ/P 7 R  p||7lW/  QXW @Bဠ@'ύ000P@@@8 1s BK0@(1,A P< nS,  Q \@.0NP S@1J/ P ̍Q /SPPw / 5^PPeN<  ;PP[En_?!b\P3M: zO=>ۅPP@SO wz-ʅPP/x% Q 4T/1 @ !居PPh  _ᦅPP nOEᕅPPFፅPPnO\Q(,!J/ ̍ sPPh q< ^PP 3S @QQ1RPP~aPP "? P4P eO!PPA P< B  2 P1QPP1 S4'PPqO, PPg  0%MPP\4Q Ϡ !14Q!RPPKZ "PP<ORwPP5RPP,"P2P PP" Q 2   "2 P P "` 20!`[4Q p !,04QߍE/pi8GISTx-py$p@-`PM(( $2$Ÿ/ R 2R  1A/@PPʼ 1Q/PPAUPP^\ x% 1t/ Pwl!80P% \P! P1 P D P 8P ,!0P P 1 P T, 8088P RŇ<P C<, d0'<P\ H 0D/xT 000Ѝp@/gX8GISTlk`l/x/|////p/t/V^_@-@PM00 ,0,/@ LЍ@/8O-AM M TPp0@dL 0S  6Ɵ/ Q 6V/X 6x/[X `6PƟ/TP ,<6(V/ T&0 PPx   \PgE kP W8 u ᡘPXEP W8g ᓘPJlEP 0W80Y ᅘP<8EP W8K wP.EP W8= iP DP W8/ [PDPDP W8 GPW ,$<4 P8 f 8 P8 V ,#O?v P< O < PQ?0 <`T4P@S@^pL@@PHP y @D$D HĝHPĝ0\+ ``P  #P0 YPPPĝ  LP P1 d",P@"W ᛗ?PL"P8P @ +|,,Ÿ("(0@0STĝPc\/P BP@Dth 1P\1L/<P } <, 1a<80P+  P' P# 0P 䠟 P P 0P P EP8 N 8, P028긐 @ T 0# ЍۍO/8|\DtZ`l/x/|////p/t/.GIST^hkn @ _/$P P U+ @ L1P U @ 9 @,<@0 @[@P V@d@ht@lx`0< @ q@P <P<DЍE/8l/x/|////EO-͟M p @RB  =]/Z =P  | =|͟/ YP dR < X T=8]/h@hh0W Q9 R6 =_ ^  <\/ *P  <̟/h l <l\/ RH <H̟/ l\ ူ埱PPO (5PP `PG `匱PP`ϱ 5PP P 8P ,+G[^mp;ύP0P`@TS L+ pWXW+[^#  ≄PPkOz }_o1PPύ0S 2t02%PP O P~ ה P 0 ,:ɟ/2 NX" ̍/0!N 8#$Ġ#,  -RBPPT D"X PR02 `CboPPCX= kO}  H8ύm#P*ύP| XP (8PPP( .ȟ P x(l0XP⡃P⛃(A`P(X P  2S R `$``vPPO`帰 R4PP  cPP妰 s4PP   P VP &13lBT/W0V/PPPXPU0V/P20 0B<$P V 0P @@<PPsh&VmXO`̒@Pb`p"UT %  0 R0S R%UC % @ PP;TT TT TT+ ᱔h5ύ RT% R RR*,%$UP BR%P\R * ,$4ύP $1 $/2PPp  N ttpύo5~P0S 42|~Po 'N p -2 S$ 3 ß/<ύ-"4C8#$#, Ď< -=- A7'Br@~P " @ 2~P2 )~PwN /` v~Pa28 ~PX b/ r~/$rύP}P; R 12"}P/ed PP\! Q"P؁ `1ύ APL!(/Qh0 0h0 0Q PPPP ⴁPߍO/@Xo8@GSM`hGIST XS&4LC'Pd-ZVp ,.A- M?RPiD@ទ 0D Cp` @B`@PT W   @@@0d@S0 (1(/ nP;0WS HS S( DS0MS SS+mS dS hS# sS wS 0` 0`s' > <0s'``pWp QpЍA/8: Q-M0PЍ/xp@-RXM@P <0h` \00^ < <R@t0 pClࠁ/PAT0 TPp`XЍp@/3,ml8O-PM<p [n<XnUn`RnP@  0pP\@nQ 0T0 X pPM@ snQ 0T0  pP>@ <dn`Q 0T0 pwP/@ <UnQ 0 0T0 peP@T p |0|/TU @@=0T DЍO/8@-0@  Q<808/P r3@/LX8 -G-MP0ppGP0P,3 ƕ,@"0@ T @#P0  4n®\`F +0  pp0XX @ P`p!@(, PލGЍ/VU 6`PiP0PcP*0QP X d0S0 R00@\\ f0L0@ 0> Ѝ0@/L 8X   p@-`P 0/@T 0R  0P/Pl * p 0PC\$HH UTp@/L \8?laV x   80@-PP M 0R  0/P  0S PPP  @@$ &,  0CQ00  Ѝ0@/?laVL d8  4@-@PM 0 ^ /0S 0 l| x0d/D 0L0^HH 04+Ѝ@/ Ld?laV8  d 4@-@M8 5 ! 0 0 4p+Ѝ@/O-QM L 2Ÿ/X@D0p03Q0ST` \2Pb/X R pW 0 ,2Ÿ/p!2p`Ps @ pT !1@PZ + ,`0 0P4@ _O<0@@DDH'p00H p pp p$p4$]P8T(p<,p 0p4@pDpLpPp?Hpvv 崴`64 v1H0 |$0x$ * X` X8 0ЍO/L2 |\84 5 : L?laV~ O-MM3NpP`{PB uP <P@ n`;   UH 0  `4"@P HP CP 2P" U  x2xB/7S X"|Px@?x)P s)P 4P!^P -PX.@-P  P!E P{`!TP  @@ +Cn `F>+0P PE+0 `PP ỨP I@ PP 0P P P ᦨPm ᡨP h@ߍۍO/e@LT8Tx   <!0|(@C`V6 FTD( P R@p@Be>@ff@K Fn (P'9'knM04~$$N@PPphg-e0 tk>k΍@P ` $@$gT uP` G4^P F MW04+ MP7`@SP@@`ТP & `40+ [Q,ᇢd&$P HƟ@4+ 86t@Ph(@$30BPSP`@ᠢPg@ᚢPa%nPP\ 5E/P\FT6'W]P噣 f'PT$`p4%P %R< ^ P[@i. `T P.p`i @Pl] 8'P,($Z巭P e V04%峭P |ᠡ <忢, C 'P#2_NT @ ^l0@4%V>inP P  @f. `[~T p x@Ƣ2M@F  &P"l͍P%~4fR ` @& 04oP M02@LuT p@嶢@epT = w< !@0!!^P堢`VM 3FTP"qNALAJ! R!_p;'V \;i`@u! 9t!Fp@'V@@T$<0 !@! !  @A4+50 &@ @ݍG/|$ TL$chCt T|X"8CXu;5 $ < Oxd@-$Q\M@@p`!1TPPT  R0/@`U ~0/ P@/P t t0l@/P᪡P@@@$!@⌠\Ѝ@/<4LX 8 A-^MK>AnC @P p e FT K =+ 47#+RP 0A$ P@`$ZFT\1S  4DPWA @ #?X \@` P`+80\^   P 0#|Cx#0 \aV   |@k`aAw j@@p4W04 4@ 0p+0"+ x2@PP7S\ Sx `P\ FT~\Q   0{@vP1\` P?0!^F\1S   D@?@ὟP9 @hhA+ `0@I@P.A@!@PP`⧟P! 7S PA+ 0@]@@@@4T] e@ _>@@``}PDPwP =\ I$@X@^ލA/    d D 4|h 3x =x<;5A-0PQBM`DQ$ @MB.@"oUD04 P$PD@;!.R$p4.QAT pW 0\4P h#@/P@P@1jP DP ß!0@@PB PU@T T  ""< @@0l"hB l K T  g @DP+0"QA. D4$@C/QX@$ ;.\1S Q0!R-0 * (A΍ A΍0PPDTH Q 0  ĝ\J@^0 40 @ThP@ P  \ 3 3 P 8@t 2@   @  QrXBލA/ l 5  <   O-5ddUU"H` `P VU (!$(0\\   3 UU U u3 PPU40PC\$\\ U Ѝ@/LX_8 X4xd35T8p@-M 2R  1/@<PP0`8<ǻ8Q8Ѹ@ᇘPN0@Tx 1t/h!L0^8PP! @3V `@$!17P@  VV V$0 $0 P  s0 VT@AP$_` ?T{Ѝp@/LJX_8Z l]4|5T8p@-M 1R B 1/@<PP0`8<-8Q87@PT▧@T@F @18/(!0^! %V`@ 1P0 PL@|P  0 V|`0@C\$LL TЍp@/LX_8 T 5O68@3 SDQH#P  /0@-@PPM 0 ^ /Ul| x0 \ \/@Ô \0]D04/@0@3@Ѝ0@/qweiV8r8$0@-PP@M@ <0< 4 ^ ,/M?@Ѝ0@/$weiV80@-PP@M< 808 0 ^ (/PAЍ0@/$weiV8@-@P88 40 , ^ $/P@/$weiV80@-PP@M xx0x p ^ h/TDT P0 \ 4/0SЍ0@/$weiV80@-@PPM 0 ^ /@ ^Tdd0X/ ^,DD00/Ѝ0@/$weiV8DT0@-PP@M xx0x p ^ h/TDT P0 \ 4/0SjЍ0@/$weiV80@-@PPM 0 ^ /@ ^Tdd0X/ ^,DD00/8Ѝ0@/$weiV8Dx0@-@PPM @@0@ 8 ^ 0/ cЍ0@/$weiV8@-PPM` 0R  0/PPLQ' RoWP1pS iP T!RA @T ^P L\A @T QP Ѝ@/weiVk$8A-`PM t1R ll h1h/TAT8!D1!PTC TPPTqQPoWT1qP PU P P', 0@P  MPPT!\ @@T0 T!@H, 0lPЍA/weiVI$8NZbA-`PM t1R ll h1h/LAT8!D1PLC LPPLqQPoWL1qP PU P P', 0@P j PPL!\ @@L0 L!@H, 0PЍA/weiV&$8+7?0@-@PPM dd0d \ ^ T/P(P0 0Ѝ0@/$weiV8p@-PP 0R  0/,P` (8`P$P,܃,@(n$P,$p@/weiV$8p@-@PPMt0t p h ^ ``/T syP, <0傺`Pў Ѝp@/$weiV8xgp@-PP@`l0ll  ` ^ X/T8D @04/0 p@/$weiV8Xop@-@R`Pl0 hh \ X/ 0P0 00p@/80@- M0@P 000P0P 0 Ѝ0@/0@-@PPM @@0 4 ^ ,/!aЍ0@/$weiV80@-@PPM @@0@ 8 ^ 0/8aЍ0@/$weiV8p@-PP`@Mp0p l d ^ \/ `0b80 RR Ѝp@/$weiV8A-@PMp`  1/@'W0S!  Q PPP0XbPP P  0/ROR RPCT P  BR@R(K :RЍA/8A-@Pp`ll h0h/@ xPP0S PCTA/t8O-pPM0夢娂 3R  3ß/@ R=3C/ `@LPlBhBU ù~us 0a$@PPh!@T^] ,PZ TlWPPP9B0l  P 2@P@ Tv"Rs ,Qp 0lRUl  \@Pf N ~X ᰒP CsO,峲 P "l0 M@PUB PT <T:UO2S3 OX ၒPH  @P%_  X pP 0P P0 P s@P VP @_OP ^HPlQhP Q 9P ߍO/weiV$84 -M $(, Ѝ/O-PPM0䰝쀝p 5R  5ş/@ R5E/.Yl| x5dş/XD\ X5  W $@pPPUu b@C8T#,Pc `W PP $V C`wჱ,@0TS\G 0^D +PW $PP @TS_00 p  00"!@PP0A P0A@!P@PQ0!l`QT T PW ڐP`PԐP $P♐͐PP 0S0P S [0 R00  S <| x04/PyOЍO/weiV$84Dt0IO-}M @LPp` $ 50  @ K0@P  _P &Y% XP! 0PP | TT l TT \0TT ?P Y 8P @}ߍO/0I@-@P 0 ^ /@ \dpp0d/0S ,8^H D00/g@@/$weiV8D0@-@PPM hh0h ` ^ X/@ ^,800/_Ѝ0@/$weiV8D0@-@PPM ll0l d ^ \/U8H D08/0SPЍ0@/$weiV8T0@-@PPM 0 ^ /@ ^0x|/0 ^ll0PT/ PL,H0,/0ℯЍ0@/$weiV8}D~0@-@PMP 0R  0/@P  0/(Q $P,m~,≯(\(ῦ,, R \0R 8 H04/$P,yЍ0@/weiVi$8jDDSNDO-P$M`pH H2R <<<2<Ÿ/@P # 2B/Q  1Q/DP @PgD _L@PT@X  0 @@P (O H*D $H#P0H3 R@P20 P @ BT"tD Hs`Hc`凕p(P<@P   0@P @P } D`H#0H3$ЍO/weiV/$8D10@-@PMP 0R n 0/U P x |0p/<0Q<HXX g<DÔ ARD< 44 \@Ѝ0@/weiV88aDbp@-L3Ms@ T L5Lş/@P ( (5 ş/DQ  5ğ/H 4ğ/H3 4ğ/H 4ğ/ RQ^0SP-\$P ,Q|$@| R _DQD#0^00S,P,(\(ب4#R8Q ^Cބ1SڄPEք\F҄!RG΄LQ`7E ^00L0S  3Ÿ/L  P 0 0L0S  2Ÿ/L  ~xR, <2PbLPU`VLOϠ 2TLQT1S`7E Q00T R  1/T!0^ 0 0TP d 1\/T 00  3\Q, 1PTPU`V,T 0 TQPQ8*4(N⚄<0S0<0x  @#R \ 0T/ 4 0R W/0Ѝp@/8,Pt57GINY0Zp[p@-`P 0/@T 0R  0P/<P< D^t 0p/DPADS< P0BS<0,TT U p@Ip@/8weiV$@-@PHH D0 < ^ 4/ 0>Y@/$weiV8-M,Ѝ/p@-`PPpp l1l/@T P1R 4D @10/U@0H1P 1/@3CQ0@0/<PU@/  ENOZ8@-@P<< 80 0 ^ (/E @/  ENOZ8@-@P88 40 , ^ $/@/  ENOZ8@-@P88 40 , ^ $/@/  ENOZ80@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/  ENOZ8 0@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/  ENOZ8 0@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/  ENOZ8 0@-PP@M \\0\ T ^ L/T(8 40(/@Ѝ0@/ ENOZ8@-@P88 40 , ^ $/d@/u ENOZ8@-@P88 40 , ^ $/h@/} ENOZ8@-@P88 40 , ^ $/l@/ ENOZ8@-@P88 40 , ^ $/\@/ ENOZ8@-@P88 40 , ^ $/`@/ ENOZ8@-@P88 40 , ^ $/p@/ ENOZ8@-@P88 40 , ^ $/t@/ ENOZ80@-PP@M< 808 0 ^ (/tEЍ0@/ ENOZ8@-@P88 40 , ^ $/x@/ ENOZ80@-PP@M< 808 0 ^ (/xEЍ0@/ ENOZ80@-PP@M< 808 0 ^ (/|EЍ0@/ ENOZ8@-@P88 40 , ^ $/|@/  ENOZ80@-PP@M< 808 0 ^ (/h@Ѝ0@/ ENOZ8@-@P88 40 , ^ $/h@/ ENOZ80@-PP@M< 808 0 ^ (/EЍ0@/ ENOZ8@-@P88 40 , ^ $/@/ ENOZ80@-PP@M< 808 0 ^ (/EЍ0@/ ENOZ8@-@P88 40 , ^ $/@/ ENOZ8@-@P88 40 , ^ $/p@/ ENOZ8@-@P88 40 , ^ $/0@/ ENOZ80@-PP@MD @0@ 8 ^ 0/TNEЍ0@/ ENOZ8@-@P88 40 , ^ $/@/$ ENOZ80@-PP@M< 808 0 ^ (/EЍ0@/ +ENOZ8@-@P88 40 , ^ $/@/2 ENOZ80@-PP@M< 808 0 ^ (/EЍ0@/ VENOZ8@-@P88 40 , ^ $/@/] ENOZ80@-PP@M ||0| t ^ l/THX T0 \ 8/$0S0Ѝ0@/ ENOZ80@-PP@M ||0| t ^ l/THX T0 \ 8/40S0Ѝ0@/rgmZ8t0@-PP@M< 808 0 ^ (/L@Ѝ0@/ rgmZ8@-@P88 40 , ^ $/L@/rgmZ80@-PP@M< 808 0 ^ (/P@Ѝ0@/rgmZ8@-@P88 40 , ^ $/P@/rgmZ80@-PP@M \\0\ T ^ L/T(8 40(/X@Ѝ0@/rgmZ8@-@P88 40 , ^ $/X@/rgmZ8@-@P88 40 , ^ $/T@/rgmZ8@-@P@@ <0 4 ^ ,/t@/ ENOZ8//6S6/@-@P88 40 , ^ $/@/m  ENOZ80@-PP@M< 808 0 ^ (/EЍ0@/  ENOZ80@-PP@M< 808 0 ^ (/EЍ0@/  ENOZ80@-PP@M< 808 0 ^ (/EЍ0@/  ENOZ8@-@P88 40 , ^ $/ @/  ENOZ80@-@PPM 0 ^ /t0S|| 0ƮT\` `0P/0L\ << V0屮Ѝ0@/  ENOZ8  p@-@P`P0  ^ /x0S|| 0勮X\` `0P/0L\$<< fV0up@/  ENOZ8  0@-@PMP L2R DD @2@Ÿ/P  "P0S  2/t  tUY@D0S 1/t8  R\| p1X/t8t0>0S D 41/t Rt" R 0/t 7Rt0 Q| 0x/t 8P 0L/0AS0XX ѭЍ0@/ENOZ< 8> H K N O R S V Y [ p@-@P`P0  ^ /0S 0塭|0\\h \/| f$0AS44 H鉭p@/  ENOZ8  p@-@P`P0  ^ /0S 0c|0\\h \/| e$0AS+0 HKp@/  ENOZ8 p@-@P`P0  ^ /0S 0&0\`l `/ E | e$0AS44 H p@/  ENOZ8  p@-@P`P0  ^ /0S 0|0\\h \/| >Ze$0AS44 HϬp@/  ENOZ8  p@-@P`P0  ^ /0S 0婬|0\\h \/| e$0AS44 H鑬p@/  ENOZ8  p@-@P`P0  ^ /0S 0k|0\\h \/| d$0AS44 HSp@/ t ENOZ8v x p@-@PP` 0R  0/P -0S dl l0\/x0VA0 00Px0(( p@/ENOZ 8b g p@-@PP` 0R  0/P 0S dp p0`/t0VA0 00Pt0,, ӫp@/ENOZS 8U Z 0@-@PMP 0R  0/U P  0/Q| 0S `t t0\/ AP88 Ѝ0@/ENOZ 8 a ,\ 0@-@PMP 1R  1/U 0/P V0S  0/p R R T l0P/0 CRpP << 1Ѝ0@/ENOZe 8fkn0@-@PM 0 ^ P/|0S| 0 P\U `0T/0L\(<< 0PЍ0@/V ENOZ8Z0@-@PPM 0 ^ /t0S|| 0ΪT\` `0P/0L\ << dQ0幪Ѝ0@/ KENOZ8MOp@-@PP `1R XX T1T/$`P$00!EP-DPPP*<PPP"4Pt$PP4@P5S cP P$@TpXPH` \0/PWP88 Pp@/rgmZw 8y   @p@-@PP 1R  0/U P  0`/$`P Q| 0x/0^Hl `0D/P@@ @p@/rgmZ8a@TRp@-C>@X ` P `P , P$0 )00`p@/80@-@PPM0  ^ /0S 0峩0\lx l/ P0@\$<< 0嘩Ѝ0@/ b ENOZ8d f 0@-@PPM0  ^ /0S 0q0\lx l/ dvP0@\$<< 0VЍ0@/ yENOZ8{}0-A-鐀MM`pP@ʍ:@D8P4  0 (a40,, @ @CЍڍAЍ/xP  Uv w城Q   +R 00TwQw ʝ 0+p H2΍nJZ`w P0P` PUP@0SP^Pʝ\P+RP PPQPAPGVxpPpx W^`PL !傣NcxPNnU` #wQpW :S`:0^d:0˝\h:0+Rl:0 Pp:0v+- ov+͍  㴙ߍۍO/ H]8 ": $c\# 0#P#G} @- @R44404/P/fK@/-x#8@- @R0/0S0  BQ \d `0`/t 0Rt0,L (0(/t t@/ 8 # # @-@P 0 ^ /0S p0形l\ h0PT/00CS00 馢@/ ENOZ8  @- @R0/ n0|S h0p/ttΠP<8H (0,/t0)t @P[ 8#_ b @-@P 0 ^ /0S p0L\ d0PT/00CS,, 5@/N ENOZ8R p@-@0 \t01`P/t0S| h0P /t UtP^ 0044/t0t03p@/ 8 A- MP , mZU 3R  3 ß/t@pk3p0S% S( S}t@ 0t `Vt@j3P  2b/^3P|3P^[t 0t 4Ÿ 0S@G3P  2a/`:3PX3Pt  @+3P  1/`3P<3Pt `V@3P  81a/`3P3P@2`P   0 (0P Z 02P(  0P EX 0 ЍA/$ENOZ 8#0$<$d$x$$0@-M@ YTP 0 ^ / R0/ 00S l0P\/t tA5PH D נЍ0@/$ ENOZ8$70@-@P M 0R  0/P PU  0/t 00t 5P PH\\  LP44  Ѝ0@/ENOZn 8s7uA-PPM@ x1R pp l1l/ RHTT1H/\PE t B 4P!S$^` p~1  D2P  0"  o1  52@Tx 0t/t0@t1P1P!R%ЍA/ENOZ 8  7$@ @-@| 0Stt0 Q`0TTX/  t00CS$$ @/G 8I 0@-$M@ ZXT 0R  0/ 0{P PU  0/P4PPll  0@S 0@@ $Ѝ0@/%ENOZ 8$  7 p@-`P 0R  0/$PP q4@$@TjPdxx cPD`` [WP<< Pp@/rgmZ8@ @-0$M@` 0 R0/t@`0  ,@蒟 pR P  @5`0  P ^W$Ѝ@/4%$8p@-,M@h0` cP`P @ 6 0  kPP.Ѝp@/@-M0@` p 0 00PP/ P &! {PP% ⿧PP 0 r r(0S $@(   @(0 o  Q [ R  P xЍ@/@- H%(^7 JNB. JP-J>CPĝ\ ^8 43B/t tMk5@P wˍ K J @t@3h@t ;$P I  x2P P? tM>TM tMNE TM.| TtZ-4M @0  @pM> 0VyP$ I΍  h1W  Q W R P810 |0ĝ\ KñQK.0CP 0 ƛЍۍE/'ENOZ` 8bD%butSc%$gi|##D&X&&&&'('@'x`'"p@-0MS@P  |aUD ?P:8! $0]00|0Ѝp@/zG-@PM 1R  1/X 1Q/Z 1q/P`t!BY D X1</P!P 01pP 0`a R`P  PP`P V 0`{P|p^ _00PV` 0`  <0PLPD ЍG/ENOZ 8''0@-0P s 3Q R@Md0ddd/%R &YPP (0$ 塚Ѝ0@/'8#'p@-PPM 2Ÿ/@T 2R  2b/``p | 2xR/Q Pp l2LŸ/ PP`2 Y00@T0@  "n\ R  2/\`@AT\h@TW 0 S! R00 d R h 1d/d R!`Q (d d1$/0`0#R00 l R ( $1/l R  h0S  0/ h PT 0P/0 0BS00$ T Ѝp@/(8OImZ` (H(d(( (((()0)@-@P 0R  0/P| ™0S `l l0\/p P Wd0CQ,, @/ENOZ 8@-@P 0R  0/P 0S dp p0`/l P V d0CQ,, j@/ENOZ 8@-@P 0R  0/P G0S dp p0`/h P VHd0CQ,, ,@/ENOZ 8@-@P 0R  0/P  0S dp p0`/d P V d0CQ_( @/ENOZ 8@-@P 0R  0/P| ̘0S `l l0\/` P Vc0CQ,, @/ENOZ 8@-@P 0R  0/P 0S dp p0`/\ P U c0CQ,, t@/ENOZ 80@- PRM0 /40P @/00^00ll P00G $z@H$.0\Ѝ0@/\)8l))0@-@PM 0/@T 0R  0P/$P|PXpp PAPP,LL UЍ0@Ѝ0@/*8rgmZ @-@QMP 82R 00 ,2,Ÿ/U Q  2a/pW  1/$p*P!0^x! R \ 1Xa/$P 0 0 8\ H D1a/ 8 R$0$0 40S  1/$4`$` `0`C` BQp lkPP dV \ (x t0$/Ѝ@/ENOZ 8rgmZ*,*L* l*A-PQM` 2R  2Ÿ/V lQ P` \2LB/$P44"pWp" 0S  2/ P   1A/(Q  1|q/^ T 1P/@{ .P / @(@0 @PP@P, 0S,0 0/8 R$P804P 0$8P`A\< Pxx ЍA/ENOZZ 8rgmZ[]^_*`*al*x{* E-PP M`p, 1R  1/Z P  1A/|!1@PV (,0d!嶖PT10 1A   0 `V0` #\`X 0S``V\0 \ d0S@d`@d@l P@lh@ l@00CQ08dd V@  ЍE/rgmZ8*OImZd(0)G- MP  ]NU |3R  ppp3pß/  X3{P,<<#P`@FT@#0X" R  2Ÿ/\P " 2<``@FPX"PxbH XpbC Z0 @pWpL,"t0S 0 2/phY.`!1``Pa0CP@ t!M @  1E` 嫋\ eX  !T1击@!V`5 @T@, &P  0/t@V@t @ 0S6t0@ t& 0 CQ(T T4 ЍG/+ENOZH 8$L #O #R U 2Ja 4j $gv } " 0@-@PM 0R  0/P3 PU 3 0/P 0@S 08LL UЍ0@#Ѝ0@/ENOZ 8 p@-@P 0R  0/P |PU  0`/t 6 t0 \P :#`P`P0 CQ0HH WUp@np@/ENOZ 8  0@-@PPM @@0@ 8 ^ 0/Ѝ0@/ ENOZ80@-@PMP 1R   1/P ^  0/!0R0{:{Pl PԌ0C\<\\  AP@@ ޓЍ0@/ENOZ 8 ##@-EMp`0SPW P P VD P@TЍ@/A-`RPp 0 \ @/0p @P0 `姶Dp ```|ᴪ40 0 0@A/ +k8myftNO-`Mp!1 廽PP`e @ {$` , p@@ @4@8@<@@@D@H@puK  `P?0 L P0  `P1@  `P(    0`P@ Z$ <P  uX\```d`h`l`0`@0PIA @H.0 $ЍO/ @+e3$crgmZQp@- @M0S0xxx!PQ XX X1X/   0Q :00PLUP  !ɒP6|P`! CKpP PP  2KU1 0 @ 0  XrP 0C\4( Ѝp@/.H++80+N0@-@PMP 0R  0/P j0S | 0x/ P ]vU]nv 0BS00 JЍ0@/ENOZJ 8LQ0@-@PMP 1R  1/U 0/P m 0/0Q  R d| |0`/Pv0 CP<< Ѝ0@/ENOZ> 8?+,BEE-@P,M`  3R 3ß/ R3s/ 0 pP 0S d#`sPL#@sW_0(#(00(AQZ d RW x T t Q"k$ ⪍PP "apPUP qAp"0pN)Pz00d $ 0嚻PPoZ Dh0sA d  P 0 ^ !0!0&Z$ \QL Q!0PK$\ `0密PP7%P9 PP!40!D,,!03dI |0 0%P Qh l0`/tB.t  Wpd^,ЍE/ENOZ 8,#,,@,l,,,,-P z0p!0`CP; P!̊6t@" @T$ 1/t| <t08C@ @R zύ 0| #C @BQ,D ߍO/tHENOZ 8./,/ $cP/t/%O-@PM X5R PP L5Lş/x3 [ R5ş/Y X 4ğ/0P$> R  4ğ/X`pP $pP! V`|PYU00p` \` R R fP WpPaQ  | 3ڰ Q` 0S  , @3Ű   QV`:@ 3! 崰00Q ß!2 娰 0Q0| 2  " 0P 0  1Bh" 2P "  p RY pW " D2pP 42 0 1kŸ 1d WPQ R`P1 P- ijP  P PPQ VUp  18X! 01@ 0*PV 1,` 0P0p 0/t0*t    BQ 0 P 0ЍO/ENOZ/ 8/2 L5 E O T Y g q t   0 E-@P Mp 1R  |1|/ZW  RHTT1HQ/Q00!̈0S  1/hQ l!| 0嗯 l!h!W |P  0PP 0PCQ`   AhQlqPLP! LD 匈 ЍE/ENOZ 8 /   p@-MPP  |4R  ppp4pğ/P H L4DD/,Q , (4d/^  4ß/(0S  3C/%R 3^Q  3c/^ X 3Tß/5S ,. \3(C/!R{MP#\Q "3[\`Q\` "?P`dQh` "/>Ed`d`Q ͠ƕ\<Ƞ@T%R^-JB 0aPD"Ї P(("LJ\|e^U R`ŕ\VRd5SVNRh%RVRl^V Rpŕ\WR0@ᒥP Q 4!1fQ !d1f Q H1 f$Q 41 ٭0$6ET].kP00 u^00| mQ ` 0\/ @00 $ 09xЍp@/ENOZ 8/0*$0@0`0000<1|1,O-PP!M M (;R  ;˟/ ؘ0+P *@T  :ʟ/t0 J| :/ R\  |:/t Rt( T H:$J/t>t@P *ֆ:Y ( Y] YjP  9I/tt^x  9tI/t 9Rt0 < )Q N\I XX)垆DN ΍@!=!-N 0 @@D @BT@(~DQ ȟQ0(R@Q(Kt  >0<00Rh 8G/t9t08(0L0%0\d0PS"S  P \P N &R\P  R \@80$Z @pQ@ `4<ğ/t0&t Q*ATC R>:x0 0* t'@T@ 3ß/t0 Rtp  3lC/t%t  R#*0\Q (3C/t @5 ^p 2Ÿ/t@0t0@ @ T5SU.lX^U΅7t( d (&h0嘫P  0S "0ᕖ"0Q 1/t0t$2PDD"%R55HQ X 2T/5H0^55D R  1/5D0 ŅŅ%($Ptt!T t@@> ,QtH D1p/,@D,0@C P(!eTLЍۍO/ENOZ> 81CD1EFH7%KNR#T#b3lLtr|$ ,-  \ xE- M$"$P1P   5ş/t@1OqP$vpMn? `0 P fO@? 0t$@ I ~u /Q<$0 x  $0Ot0I$0$ 0# 0S0#\  3c/ptGPt& Dxx#夃!$@P B "P 2v/S 0 #pt0"f R aV pU XETU I$ PP 0t"B 0S0X8"W\ < 2a/,p| ;`M| ;@DP!6@T ` 1\/Xŕ U0  00` kP30S00  R  0/ZPZP  '0CQ@ ,` ނ$)ߍE/1871H222243\3t33 p@-PP R 1R  0/@``P PU  0/,0St 0pP/,L,&P` @R (HH wU p@p@/ENOZ6 8: ; x> @-@0PM0XX  Q׀ R  0山Ѝ@/&A-pP`P @1R 88 414/V 1 A/U 0/  s=n@PP'  Pᘀր`P  ƀPP PP  2PP PA/ENOZ 8pi3wroFA-M 4 `:0 @ 1`V R  2Ÿ/pW X  1/ 1啀m? t,P i!0( C/P20  oX@P,  ^( "z0S  @P ,| ᠪ@ 00a  / AqW  QCY ⺁00aWm@P \ ? /ލA/ 5wroF_38ENOZa $444p@-MM$I 9$@ ; R$< fR  6Ɵ/INt6 0P@PP&dQ 0 06Ɵ/@@$ t0@$e Q"t@@-`P$\ 5E/4P:X| x5Tş/D| !Q9B.a R 1S TK.` QO`P (@+{0$^ĝBK> ^$5(EQ; ŒJnB. ]`P0JVPDT4^ 4c/ĝt%t 4M{D`P [ˍ -K@v@3x@ P P `$t >PT| M>TM t EN P4| EnM TM΁| 8$tP$P D֑I t2KN@dĝt%Z-00  0 !Ÿ `M> 0I]`P DD妑I> 1@P`@`@ĝ\K.V ^D ,1/t 0t0^ T(N4  @\Q K Ѝۍp@/DTK΍ޞ4 $Q*AT@X5ENOZ 8$&'('@'45:G-~MN 7nύ0P11 R! R  >~/> Uύ1p? EM? y PP``.2,@T T!te8PUP 8/ 1 R  ?͟/PP^ >͟/t łt`!0NS0` .~0l-g0>RPLH-0p@Tx0 M^  0PP2apWp -~P  =̟/app1 R \ =\L/t0$t PQ@^  D<,0!,AV$,EύU?0tD! .ܔP= 0VUP A<+0`Va eOP yAᇧtE>0SS S718+?0\ ,S~ R  ;ʟ/1  ^x  ;tʟ/t 5t0@!NQ ( tUET*1Q1pP0  p@T90*q PUP *}Q d  :`ɟ/qPP1P $ H:$I/t0t`a AR 8 *}T   9H/0Q@P(0D!Qh)}\ H |9Dȟ/  0S  ,9ȟ/t t@!0CP  4)}  (0  x@ s Pn` iT'0000V^'0U PVQ h'0U P'0L{ύ0 0HP'Q`P &nO9R P(&(}A@n` 66t  ^oP y?M P Dp @6R<&0UEg I}q@PUPDt&|a0S $ X6 ş/q``Ap]Rp BP&|ApPUfheύ4 `y5S t4 05pt/$p"P@%|@PUE@ P<@%U@@Q,%|0S  5ß/ ,B^,Pt$|G,呋t+ ]/P t0PPt@TC IO$` ^ttAҢtE*t0SS S#01*@ 0S0p *yQ T  p:Pʟ/t0 @Rt  T3$@<*01@aw0l' 0L`P * 0= Q )jy0S  9|I/tAPtA @ h)SyK) 0  >@ t9T 0<)@5P$) 0, 9 Iύ p t00΍ pAlAhA@PZo  0oPp0 hPt@!pTpM[IOpN$ P(x47 PD [ 0la`@@PZ 0oPl 0h``s @oT[ 0la``‚PZ 0ioPl0 h``s @oTpMP` P  opWp8&x`V  APxx&x l\0S  PHH&vx]bx R  %jx@T  5|ş/``WNpW@ 5<>Rh>T>>V>cE-M P@ U` 1R 1/ V x 1ta/p  㑀pD? ,`V  C`P0 L`P 0`P  0 @啇 0} #v0S \ 0@ KPV P 0a QЍE/yftND=8E?,?L?d?G-~MpP L2R  @@@2@Ÿ/  R$$2/sL| .  Pg `^; 6S8 "P P 1| -[| -?넀P| -_O\  F0@Ɩ/!@R T&~/"P  1 P 5| 0 0ŃD-P吠ZP>~ߍG/yftNK=8Lh>E-yM$`V 8R 8ȟ/ @Qdll(t PU DL L8<ȟ/ 00 t  $@@U Q ^ D r PLL \0Sp F/@ ? p0 'Reύ PU 07P    7F/!R  6Ɵ/ r/Ɋ@Pq K@61$~@P nh}@P0p⏋ᐒG H(0S $A( @  @1(0qAAq}P }Pn4}Po|@PP\%!t R@x t58ş/uh0C^DD% t9:si >j@PxVRG!0 @@oPkHPgeOkHmOʠ !rPPX!rn̍0)傠NrH@sGT?L! 1PlA@! P PQPP P1@@ QFFPAQ(0S P$P( P  P1(ZpQQQQ\jPs iQug!Rq6y^pATnxQUoq11 \qyPnxr>TjP  F?@v/ ?  "0 %Q  Uu/P(_P@ @ P P@1T ( T (| + P!t@Z-@  1@0@` ( 0LP@P P  *1Sv+wӈ@ PP AP4 rT$"syߍE/yftN=8><>?\HENOZ ?8#9x#;#?;>0@-@P$M T1R L D1D/ ŞP> $!0    0) 00 0VP(PP) \ }r 0S | 0t/  P 0CQ,LL ar$Ѝ0@$Ѝ0@/yftN=8  P><>>O-MO@ *0PU Rʟ : / :ύ@  :ύ@ t: P l x \:Tʟ/T: 5Su Qr #NgP   *qp0@S* R )q\  9ɟ/Pt0  ? LP@T xx)qp0CQt #PpNP<@T@)qQ  8H/\ 0R0 #lPt""Po@@0C\Pt(qT P @0P(cp @Rt  p#>P}o`Db@b<>>0@-M@P j'T@ 3R  3ß/ 3U8 dP4 hq1 ^@^ jP% T5S0@(6dh0  _P B\ @b0"@@X0"{@0Q|"n \ \x x2XŸ/  ^ H D2Ÿ/ Tt0@t@ ^ 1/t@$t 0U0UU .S*t0 S#PUT x1PA/t0t0 QL 81/@t t PU @0@T 0/@tVtP%RYfPY.RP0@S04tt mT:Ѝ0@/P@ENOZ 8$,-  " * + / 4 @-a` P`4 0 f `c BPh lmp LR D cm|V mm`<Ѝ@/\@ENOZ 81$#$g#@-pP M R \1R TT P1P/@P$0 ,1 a/`AV0`070PUP m R  0/PPP Z !P eV \| x0X/ `0BSH(PP lU`i Ѝ@/ENOZ 8 p@  @ O-M4M?}ʍ`. pA,c(c8PB= L^g@DP, Rg K@ ֘,, dP00,k@?mʍ< `,( kP0$呉P \PEچP ᆉP$҅P.*K}(p 0@ @hP! "AJ=@PcA 0P u*Rlp$XP Ř\ `0?m /@p.@B^P, Id fP⌃?  ? 0 @``P`i@P' ̙ T? 괹 TYyT>JmP(<A `p 0PPP p`hPP?$ U? UTŘ\@ IM?-0`  /@I]P?P?̍ P?Ps w?p?P@ CnJ} +`F(p⅏+くXT 00D(T +  ᲈP 8ȟZ Tx@4 C.`B0@ '@@tZ) Ř\& l?= @JI @(0/ǟ T '0`tT 0@N.B+6 L'0`@HI=@F?P ? `??PgTL☗K 0@PK-` >K:@ (0@ fP?̍@G7@  PH &&kG 4 $+P 5S ?]  /~p`~pGV@,``< ee  0PPP pPPg@Pd P%T   0PPP pPPg@PT 0?PA C +J⧎ +㣎4TT ğ T0$7T x@`$0$Tx` >@C+xh$0@v Ř\TQ  /PؖK-p?PKMPR 5>6SK@ (!0@ fP2?,@Ft? APL#cjF=@4 ḃP $bP 5S ?]  /~p`~pGV@,``s dᜁ  0PPP pPP.g@Pd ,Ÿ T   0PPP pPPg@PT .?PB C +Iލ  +ڍTT T0!71T x@`!0h Tx` 0@A+㯍X!0@v Ř \ T R  /0P00K͍>PKMPL l=,(`,h@T :(P̍(`,gߍڍO/$c\@3@@ @AaDAtAAt AAB@-p MP`!@!@| |0 ͓PP0  P;P04 PK ,  0D Ѝ@/8@BHO-M 0P000p`tP )EiIWW pAP&W)T )WF \@z0x)8 a0`)W0 S$ @ <9> ю` \P @ 4c P%11!_a@D@@@ h0導$ ARH a(Ѝۍp@/ENOZ 8(GO-PM@ 0S  3ß/T 3S/ 1PXll#ad@#`3PP` p   pӄppppp $`P,`0@xff f$f\````d`p`t`x`|``Fh+)'%0ΠK/<@ ````````halaa\e`edehelepete|eeedAxEeŅŅee(`eeV?R;>NE> 6!f% TeXeeeeeeeeffff%P!`PD!D,%ŅԅeeUUeeЅP.Qʸ 0/0C^  0/ R00T aP004 ` 8 0\ЍO/>4G8?tZA7,B$u 'ENOZ1H8p@|10<10@-@MTP \4R TT P4Pğ/ @Q $4 04 T/^  4ß/ 3b 0S0#`P  3S/0tC@PQt"X#`PPB $P(dd#`%<R,UU55 @^ ( $3Ÿ/5@0P55P< R  2Ÿ/<05P $LP<"E`TPH\h8":`Q L 2/UPP ,P 2/, 0B,0P*7P`PDtQQ PTPYQ R010/UP0P7PU(0S (, R4 1P/,A,P^\ 0|P/ttr 0ASP 00d _U Ѝ0@BЍ0@/ENOZ0 81dG2=G8:CFGGJSUx o{}E-AMMPPp`0 <1R 44 010/V  1A/ a  0P@@PP  $^ /0P0XP@PU00SP  `@d;T T 0 T@ wWPЍۍE/lbTZHjH8kPI- M00 Ѝ/0@-@PM  P 0 ^ /ᇝPt`p _ d0 @@r@ P@ < _T@Ѝ0@/HHlbTZ8hICIp@-@PP ` 0 ^ x/NP\LX ^T 0@ӝPA( ^p@/HHlbTZ8hIDIp@-@PP ` 0 ^ x/PLT ^P 0l@ᡝP$ ^p@/HHlbTZ8hIBIp@-@PP 1R  0/U P  0`/ `ޜP j^Q| 0t/0^H T0@/QP, J^@p@/lbTZHH8IJLJ`JtJ-MЍ/-MO 0PPЍ/%O-CM MPլPX᪫[ P\PᣨPG XEPC ' ! 1PP; P ᣫ` @BP =P$Ȑ$B 68` 㼆 `Fᬬ+㬁PZpp [x@@Pl$0\\ Pw <ЍۍO/Q%0,m3HdKXK8>0@-@PPM 0E ^ /Up| x0l/L(\ ^P0</ (0/Ѝ0@/XKKCTSD8pL@-@P$$ 0 /$@/XK(80@-@M0PS  1/T R  0/U 0P  0/T UT  R1P (0S /PЍ0@/>XKdK8KTSD,LL0@-@M0PS  0/T R  0/U 0P  0|/T UT  R (00S /PЍ0@/>XKdK8KTSD,LL@-@Ptt p0 h ^ `/(@$H^ @04/(0$/@/XK$MKTSD8M0@-PM0@S t l1l/U TR <H D14/T( $1 /0S004 S SS S S S SS S 01)00000 000@0Ѝ0@/>XKdK8KTSD$M0@-@M0PS  0/T R p x0l/UH\ X0D/0S0010Ѝ0@/>XKCdK8KTSD$ME@-l @0dS \0\\/P TT TT T@/>dKXK80@-@M0PS  0/T R  0|/UX h0T/P(0,0S/Ѝ0@/>XKZdK8KTSD[$Mdkp@-PT@0`S @@ <1</U $RT ^  1/V 0/lP%hP!$ R $0S Q( \ (0S P\  (/84p@/>XKAdK8KTSDBMC0@-@PMP 0R  0/Up| x0l/P  $PH (00S8/Ѝ0@/CTSDXK1K82Np@-PP` 0R  0/V 0@/@P$Pp ( Q $0S /P (0 / p@/CTSDXKK8N-0MЍ/>-8R0 M 0  Ѝ/>>G-M,PU@(`(( $1$/q!1TppV @@amT-:EXP c`\/V:X 0R 3X ~`PN  @ aP :  0Lp@T`ЍG/XK_N8N3NHK@-PP@p` M 0 | ^ t/TT   T<1H0@/p`0 x Ѝ@/XK$MKTSD8N@-p4 M0S $$ 1 /W R R  0@/P$ `^ ((0S 0/((/Iw| X0 @, ,, @jL, 0 @ Ѝ@/>XKdK8KTSD,OOp@-`PPMB 0 ^ ^ @/@ (t0\\\/ (/@0`0 0~`Ѝp@/OXKCTSD8 |P@-Pl M0`Sp T L1L/U 4R  1/V 0/W 0S  0/(PX $ RP t 0@PP `(0/PP  (0~8@ Ѝ@/>XKdK8KTSD$MtZPCTSDO- M8`p,!1ᴣЁ0P, @5  0 , ÁPP, 0 n  wPP, x0 ;~\0pP, 3~@  `$00<0弡( ЍO/XK^KTSDegmn>O-MpDPH@L`尤nP LLL1L/U,4 01$/T 1/V 0S  0/ 0@lP@ R s@P (@00SZH /@P Q@ЍO/XKP8XotZE-Q@pPM`0 /Tpt p0 ^ T/ 0p@P 00$ЍE/PXK8p@-H!M0PS@`P (( $1$/T  Q  0P/'P  0/V 0P/( 80SX  fPP fPP(8/PPfЍp@/>XKkdK8KTSD$Mm QnDUO- A$M^@ 0/)R  0bS$ZSPSpS`  0a\FSX  0HP0 H $ЍO/>$QXK!8O-!MM΍P;.`  S8hOfpP`nN @, 8WWWoa8`8epP8  bpP(PyQn͍ `=@l^  GPm,H~^ P ;P,  Q!0 ph{pPU8  apPO@~R|P8  apPB(P<~P 8 apP3((R-,Hx P s P, !!0P~N @ A,O; 88 @ pP  Q~ 0p pPp8(R gePDЍۍO/Q (p@-PP@0S @@ <1</U $R  1a/T 0/z`P)(,0Sh$  bQSR QQ   0lS !BR$Q (`,/``p@/>XKdK8KTSD$Mdk@-SMML@P A,TOR~p`PO- Mߍۍ@/O-AMPpL@P`帔 hh d1d/&lP D0@14Q/T$ 1 /V 0S  0P/PP'@ D0@ PP Z 090 ( 0SX /@P@P P ЍO/>XKdK8PtZE-@M^p`P |0Cx/@@<@ 0@ @PL@P D0 xЍE/>XKG$Q8A-pMP`f P@00S.S@@ T@d* P@D TA< P@D0$  PЍA/NN4QO-S,M@\p$@ @@ tj l3lc/YLT P3Dß/40 ,,3S/W 3b/[ 0S  k2B/ P"2}`P  2~P d 2\/$ 0~d@ 2DzT}P $   Q$@P$00o @P \$@1 0 $ ḡ 0SM (8@TA `H!1}PP@7 h1+P X @1/8 c@P+ c@P& 0y (8/@P 7c ?@P 1 S@ HP'c a @Π 0y,ЍO/>XKdK8UXKzdK8{PXKZdK8KTSD[$MXKdK>B>>@-PQM@P00` 0/p0S  0/ @@tf`O/ `@Pt@P@P t@P h@P\@P00 Ѝ@/XKxQ8>Q>>>>4ADAHALAPATA@-X@M@0SD  <0崎0PB$$ PЍ@/B1HCQ@-@᭎@/0S  0$! //@-@P44 000/0S00@/JSS8(3/@-@P44 000/0S00@/WSS82/@-@P0 ,0,/0S00@/SS82/@-@P44 000/0S00@/qSS8h2/@-@P44 000/0S00@/~SS8(2/@-@P44 000/0S00@/SS810@-$PlMU d  X00f0@0>0.D0gP00f@@lЍ0@/Q 0@-$PlMU d  X00f0@0)=0.D0gP00f@f@lЍ0@/A 0@-$PlMU d  X00f0@0>0.D0gP00f@D@lЍ0@/1 0@-$PlMU d  X00f0@0>0.D0gP00f@"@lЍ0@/! 0@-$PlMU d  X00f0@0>0.D0gP00f@@lЍ0@/ 0@-$PlMU d  X00f0@0>0.D0gP00f@?lЍ0@/ p@-M`*K0P@  iy@P@  7 P@R   ߙ@001$@0 Ѝp@/SG- M @ 0@@PP.pP@ TR 0RP TwITGJPP;PP@pl`Z:@ =@d ЍG/Q 0@-$ PR@MXX0XX/  0a!S0$:M0Ѝ0@/ST80@-$ PR@MXX0XX/  0a!S0$:M0Ѝ0@/S0T80@-$ PR@MXX0XX/  0a!S0$:wM0Ѝ0@/SXT80@-$ PR@MXX0XX/  0a!S0$:UM0Ѝ0@/ST80@-$ PR@MXX0XX/  0a!S0$:3M0Ѝ0@/ST80@-$ PR@MXX0T/  0a!S0$:M0Ѝ0@/ST8p@-$P@`M@ ( $0 t0$0Ѝp@/Sp@-$P0`M@ ( $0 t0$0Ѝp@/Sp@-$P `M@ ( $0 t0$0Ѝp@/Sp@-$P`M@ ( $0 ut0$0Ѝp@/Sp@-$P`M@  $0rϠ ^t0$0Ѝp@/Sp@-$P@`M@  $0 Ht0$0Ѝp@/SA-`@@ 0AThM<@0Pu U DpPP  GHP@ ^hЍA/-$$0M  S\ @  p3Ѝ/-$$0M  S\ 0  p3Ѝ/-$$0M  S\   p3Ѝ/-$$0M  S\   p3Ѝ/-$$0M  S\   p3Ѝ/-$$0M  S\ @  p3Ѝ/-M0L?S ;TPЍ/@-@ @ 0l?S 0S@ H0@/- M SЍ/0@- @PT M S($0.[s0 0 Ѝ0@/S0@-P$@< <0Mv@P@ 0 T @0Ѝ0@/Sp@-M`^H0P0  v@P0  k P0R 9 ʘ ᛖ0001$@0 Ѝp@/SG- M @ 0@=PP.pP@ T) R 0RP TFT{GPPoPP@pl`Z:@ q=d ЍG/A A-`@@ 0AThM<@0P U DpPP  mF=GiP0 hЍA/-M0L/S SPЍ/@-@ 0 0l/S 0}S0G0@/- M SЍ/0@- @PT M R$0IΠ.`r0 0 Ѝ0@/S0@-P$@< <0Mu@P0 0 S @0Ѝ0@/Sp@-pM`hdGl0P   u@P  ql P R i l h ᑖ 0hl01$@0 pЍp@/SG- M @ 0@<PP.pP@ TR 0RP TETFPPuPP@pl`Z:@ w<d ЍG/1 A-`@@ 0AThM<@0P U DpPP  sECFiP hЍA/-M0LS jSPЍ/@-@  0lS 0S F0@/- M hSЍ/0@- @PT M Q($0 fq0 0 Ѝ0@/S0@-P$@< <0Mt@P 0 FS @0Ѝ0@/Sup@-pM`hiFl0P  t@P  vl PR ֗ l hi ፗ0hl01$@0 pЍp@/SG- M @ 0@;PP.pP@ TR 0RP TDTEPPzPP@pl`Z:@ |;d ЍG/! A-`@@ 0AThM<@0P U DpPP  xDHEiP hЍA/-M0LS SPЍ/@-@  0lS 0RE0@/- M SЍ/0@- @PT M P($0 kp0 0 Ѝ0@/vS0@-P$@< ?Ms@P 0 R @0Ѝ0@/Sp@-hM``oEdz?P  s@P  |d PR Ĉd `R0`d01$@0 hЍp@/SG- M @ 0@:PP.pP@ TR 0RP TCTDPPPP@pl`Z:@ :d $ЍG/ A-`@@ 0AThM<@0P U DpPP  CODjP hЍA/-M0LS RPЍ/@-@  0lS 0R!D0@/- M @RЍ/0@- @PT M mR($0 ro0 0 Ѝ0@/iS0@-P$@< <0Mr@P 0 R @0Ѝ0@/S[p@-`M`XuD\0P@  r@P@  \ P@R d \ XRg g0X\01$@0 `Ѝp@/SO- M @ 0@9PP3P@ TR 0R P TBTC PPPP@lpY`#`3U`V@ 9d %ЍO/ A-`@@ 0AThM<@0P U DpPP  BPCeP@ hЍA/-0MS  NPЍ/@- @ 0bS ]N$C@/- M ANЍ/0@- @PT M :4P 0Qh 0d/04 {900S067, R,(P(.7 Ѝ@/EHCA 08 ]6<^x 2t/ < ]<$0#00fHP @ BPe hh"V?` (Z $( 0  0 ( 0 0 0S@  " 2⨢ BPR X!(?L ^00 (Q  1A/ 0(0 \ 0 0 $^ 4 41@/  $  0@ 4@ZD$@T @8 Q6 R  Q50S 3P \ ЍO/TECAЍ@/,Q,A>p^'( 0S0 0=0PUCN0  d P0 0\ll =\00<TT =0H0/0!m Ѝ0@/EHCA\aBb8bEKA-(00MS`@P  2Ÿ/X 2R/ R R  2r/0^\||": P9@\ 0X T2,R/ q* pW LQ  2/ L  P00 H0S  1Q/pHp   J,0”S202$lqPRp@Pq"H 2@!00”R P$”(R,PTh 10CP x:|@$P\ 0PT, R pp 0|T($0ЍA/8@-@ MTp |1R tu l1l/PHP L1@/0CQ`P =0SSS4 `Y$ <@` ` @` ` @$ h@( @ @\  ^  p 0 `ЍA/hlcaDp@-0` 00@PP PPPp@/@- M0P0%`p @P 0v03 R@P00p Ѝ@/  A-<`@v$$ 1 / R00 Q\0S  0p/\Q00 QX\  0p/ X p<Q0SHd `0D/P0 BQ p3A/jj8jjh?j/@-@X0SD0  4!0(0@ 0 0@/,O0O<A-p@w,, (1(/ R00aQ0S  0/Q00`Q R  0/00`QPHl h0D/X 0BS p3A/jj80Ok,ODk< lkx~0@-PP@ M 0 ^ /0DP xT T P 0$T< 0R Ѝ0@/jkbdaD8@-@PMPp` 0R  0/U Q  0/ 0n@ 0S0d|| 1 0 0 AP88 1Ѝ@/bdaDj] k8IAda^ la lj l0@-R00M0@0 QnOp@/Nbdajz8@{{{,| x| | |0@-PM@KDP HAЍ0@/A-@Pp 1R  1/0`V dQ H P1DQ/PUp0s S*|0S  n |4 4 pPUt0s S*0SP  P t4P 4 tPl0s S*@1l0A/Nbdaj|8bdaDkL}d}@-@P MPp 2Ÿ/ 0R 0 R  1a/0`V \  1|/ 80 R QP-  |P @@# P@PPT0SU  0@/@4PU P 88@0S _ 0S [  Ѝ@/jq8Nbda|bdaDvk|}w@-@P Mp @1R 88 414/P!(A僾m 0P R`  (1X8P BP  /Pl (P R @R 8dd (0CQLL ( Ѝ@/bdaDj k8 } }  } @~ x~p@-`PMP R 0R  0/  |PQ0S@Tp0s S*t0s S *l0s S*0 @Ѝp@/Nbdaj~8 E-q`]@ Pd M 0S0 ( P 0C\ P(  (P"QXPU@/ PP P@ \T04P0 CR ( ' ЍE/<j}/@~8w0@-@PM 0R  0/P 'P!PPx 'UP!PPh@d 'T0U LR @@ 'Ѝ0@/bdaDj k8 } T  x~A-@PMP` `1R XX T1T/U <Q 0 ,1q/ V 1/pn 0 p@T@ V' V0@bdҼ@ ͼ ɼ f@$@@0,0@S0@@ 1'ЍA/bdaDjA k8IAdaB lC F lT l0@-@` M0XPS LQ DD0D/!|  Ѝ0@/0,jv8@-PP M@ 1R  1/T 1a/ R  Q \t p1Xq/`V L1R @ <1/ rpp 1nL@P &,00 (`NQ| &1pV P@|| &m 0BS0\\ & Ѝ@/bdaDj k8 IAda lEbda ty l l } x~p@-@PM R 2R  2Ÿ/``(PQ("O& @P( .9P  1a/1S`Pf>N_ w`P[ `>`+`S'S Xd `1T/ /?:P 0 ,1a/V`P6>N鏍 dw`P+uO ]5 #p5P05 50  ;0 >`_V >`ЍۍO/̐j\884_G-`P#M 3R || x3xß/0Z \Q @P L37B@R  >Ο/Q  RT``>TN/`0S (<<>(Ο/d\ >M/|P ^  =͟/tQ 3P  =M/  d =d͟/pPpȬ L4p- E@P@C ",@\h<4 $lp80(DHLPTX`@d 0S0 ,0 N0R00 d ,<04@b4 P4`4 @4@4P@` Q \ X<\/D@傱  1- `V$`   , PXP8`5P  80@  @  R PU` ˟ @T A4P` ``+`@U pr ` 0 ,;崺/ V\0@00%8娠0p 0 R \0SV R P u*EPV 0@0 R U T<H*CD`P @a2 `:@PP <x):@4eP` T )`@@E2)< lpt@04@8@x@|@@@@@@@ !X0S`\` @X8IX` < 04800804 0@80@0804 80 0807`V00 A\0S  8ǟ/\@T00 AXP L L8g/0X0000 `@X RP\P@ XXPppP0'l r p R#%*|`V.p r p@R(*% p )@Pl )`\'TT @@7TT5 4ǟ4gT T (T @T` ` R"t r p0R* p P Ɵ P (@3@BT6PP P` |@T  0S  V 4"!2@#  "@  P    P  p4`(|:;p !n<ⰰ @T@ll%  ( 0d P0<0"@PX   R@0@0@@AT@$ Z㄰6Lp nL0 ^,td$(d 0P"@P 0 S@@ @,@LQ# [ 00y0 !n̂0`@AT@x#i4 0`S\A` @T`0 `P`,V* 8P40 0@4Tp 4l 4p4004@0 4@4 44 4 44 44 0  4 P0044@44@40 4 4@4 0 @ tP  @7@P A40  440S |V0 4 1/00qn0 4X 4P4 0T0$0AS0 49<78@<D<7@ B`Ps@@+9@7@xC@r7@D B`PaD@9D7D4CD`7H zB`POH@9H7HCHN7tL hB`P=L@8L7LCL<7P VB`P+P@8P7PhCP*7LT DB`PT@8T7T$CT7 +o`P oPV0S|lHPD!8 tHP$!0<P<B@ R@BDQDBH^H}BL\LyBP0SPuBTPTqB R0 0  ! Q00t!8^080T \004  H 0RF ЍO/jS8]Lg<` h?/<x~DLXdpxbdaDNQȍceLgiԎk@-M @T 1R  1/ P00 dpp!0C^DXX!k<A@ADAHALAPATAn,HP z HP qQ00 i^00t a80S080T Y R0 04xx Qtl 0EЍ@/bdaDjk8}x~ȍLԎ<A-BM  5R  5ş/ @ R$ Q p |5lU/t0`V X^ 0L H5,ş/PP Phfx \Q h0 D 80\0 \PBP g4 Ѝ0@/$$$$8UԒp@-PPM 2R  2Ÿ/P F 1A/00  $3(Q(f8^840S4< R< \0 0`Jl!b\Q @!T17\@TXQ@ X^ 7X 00TaT 0@@@! X08XPQ 07P^00p &\00Pxx  @l00 $` 074AЍp@/$$$$8+5;=p>Ap@-`PMdV \1\/PU @1R (4 01 A/PW!\ 0@/00CS00@0H00nP @N 0*P@(1e@LQ,\\ T Ѝp@Ѝp@/8$$$$Zl]^00@ll 6@4`` 06P?ЍO/8tZ$$$$  p p@-$0PS`M 0\ @T /V 0||@/ P;  [ T @1HD@ 0)`$Ѝp@/Ĕ8!ĝ0@-<0M@PP @TЍ0@/BG-`Pp  1/X 0S \h d1XA/TAP2<;DP,,!PP DP5  / 00@P DP" 2 P@ (P| ^@P@PH@DPL< @G/ᬘ|\8BBHĝB*A-PPM`@$p 1R  1/Vht p1d/!X  R0DD10/T 0(S  1/ P 0/!R  0/W ^P T 0P/ 0@ pP/ЍA/DSND80RSNDpbhG-@PMP`0p48 1R  1/U 1/V  R V00S  Xll1X/ Q0L H1,/W ,R  1/P 0/1S  0/X PiP P 0L/ 0L/ЍG/DSND8RSNDpbhHG-pPM`@8PP  \P0 0 P0 00 X` \0\/ 00(< 80,/Ѝ0@/ ,> K8O@-@P 0 ^ /Zx 0]h0S` D0 {0 C\00 @/z,psiD8~hG-~M`P0S0&Z8100%. @ @0" R  5E/  @ <D@0@S0<TT%TG PC,@T <@ ,P 90%A^  LE- R z0@P!Rڌ4 / P1 bO@9 /0 T$%qO@ <4}.P @ <U #, 0010\# @ <>L/8 A 0@pW p@t# /8 @NpPLßL#0Zm @ ^oI @kIT @ <0H PH P@HHH H KP KP @,P @ <Y4(0,0/L0 | 4)1 T \(0 $0( ,1 t@@ 1 1Z 41p@ @$( {eO LQ x WNP Ld L 0Zd 0VK}~ߍG/,h@8XoP 4<@\@A4 & 41CX4q P&l R 44&z  @P  6ş/v`@pF 0S0D%^20 P-Z7  ^ @P @P P` BP @P  zBP ` uP qBP LQL$ @T' P0R ␀5      g(PAI$PA0  ቑ@PRa% b7@PE  /@P=p@ P |@ ,0AȠ,$,:|P7@P" @A0@0 @PT  剏@P0h 0h0 *P  *ЍG/DXo8pi(.(*)O-0M`P22 4ğ/Xx 4tD/  RDXX4DT/X  PL†pQrrߡR Ry2K/KC$"($pቡ, Uṿ`Ra  Ő@P 0pT@P_p@P  h@PO ->X@Px" R 2Ÿ/ 0A2?@PwN@Pr\O E"+>P@`Ph ̍_%@PZ )B*@PR_+ @PK 0 (T@PB<% `1``B/B@P2 2@@ @@B R 2@@" B@Pd!P \PP2SxU  p%` ,0 `"QߍO/ᔻjpi8k(n$E-wMnp! PR㬠0 ࠑ/01僋@P,  W  $n P@ 4 !h@wߍE/8л-MeЍ/O-M`0pK0  @P0 0 >P P i  \0VuOP@  0,Pp ЍO/ᔻH O-PMpP@`S? 4ğ/XtZ x4pğ/TL\ X4Hğ/Y$< 84 ğ/Z 0.S    4S/  ?PP h&PSV w ^&PSX&PSi Q /PP  PP`4@ A7@ P" aP 0?v_MCK/f nR*#M6&t -?PPV`@3V`Ý @bP) T?PP 3* P1U`d%%!/! 6PP`3#"PP@S鏍V %X#娌  PPP#0 . 03'U `R[ 0RP 0 1|PxP'ߍO/ᔻg|\8Xi(jtZk(*)l  ̼+_-M0PЍ/_O-@MPp`PCC 5ş/@P |5xş/WX \5Pş/V0 85(ş/U 5ş/[ 4ğ/Y 4ğ/P$4ğ/ 0RT%*ᱞ \ 02ṯ,.$@2E̍သ @"P20C20P2R噞=@PP\ h#0P8P 3  PPO} Ý. 0)QPP /JPP bPP `8@c  PA""6nwOB/#ᗝ{x >.?oPPk$`@3V`#@ôP) 嵈_PP H3 1^tKt%%!/!S D嗈PP`-#L!PP'@Vl  P%lܜ ! al~Pl@l府 @4P@&Pll P缜 l RlT|0p03Z0#SPZppp@iP0lPlW @LJZ@DtЍO/\80-M $(, FЍ/@P/E-`QMpx5 p2pŸ/00S L6 L2DŸ/HPP@4_  $ E $ XvO*~/""(QpH t1h/"() " 2+u,0 ᗂ. 0^"/^Q 0/"/.02+ "E< ᗂ 0 /9" + ?NߍE/t(8|p@-PM`-x Rt0t0 0S  0/ttQx0x0 ^ | |0t/x 0x0t0@| 80@U @T 0K Ѝp@/ľо8@-pMPP` 0 ^ l ^ d@/@6H~!p& 0! `pЍ@/ľTdwF8A-@P`PMp 0 ^ / P\h ` 0ILL0P@@ !P( ЍA/ľTdwF8@0 E-pP M@ 2R ^ 2Ÿ/ !`02 PP`r `( @P| D T x t 0Sx@@xt@x`Vi0|h!@) PHtL!  O` Pv!V1:x\t0t0 P  0/tt^x0x0`0S  0|/x xt| <0W@T 0M ЍE/TdwFľ8 оA-QMP 0S 7 0/ 90 @P` p 0GO`P `P`ML@GQ 0ЍA/ľP81 TdwF0@-@PPM ll0 ` ^ X/0 S0800/@Ѝ0@/lbaT8ip@-PMU` 1R  0/P 0@/@AT@$0S  0/ P  @ R P X0H/@ 0Ѝp@/lbaT8(A- 0M@p` P0P  0P-X R Q  0S R   2 V `V` Q R @@R U @5T 00ߍA/,CE-`P$MP@ 1R D 1/ PE 0p/  aTUT0 p0  !@官iX  0@@~P  T !0SZ$0$00$ЍE/lbaT8Hh3,Cp@-"0M`p @R PP @80<   PP00Ѝp@/lbaT0  ̀0/ < ( Ġ0 /0@-MP@Ѝ0@/0@-P@MЍ0@ P00RccP/$RQllPa/p@-@0`S@8 P> P PU@0 "P8P @P0@P 80Q: P8U:hh d0d/@0Q R 0 40,/@0 p@/TK`8|(/0/@-@PPp`M< 404/1 0 Ѝ@/T80@-@ @PMQ ᪗]Z Ѝ0@A0@-PM0@jo P P0 P@)D@< 0P!"Ѝ0@/PPm,M,  @ a,00mP @븓#0pcm MO,<3@"d,3OmP 4ß #0pLP  PB"0 0 2 0Py\P@ Prx oP |LŸ @@"0@(0 8Q6  !2P<H  bPB8|!1P@@/@-\@ PX0!h0 !@.@/p@-PMU` 41R ,, (1(/<Q 8@!0s<@Q 8 0!g0@0Q @0@ \pQ xX0t QpPjP0@@0F/0C@Ѝp@/RUOJT8O-MMhl pẑPP@兒PPEB.B%0*@Pe ``F0%v*@P[^  0 PPP@ 0P0@0TCl(4,\ (h^00lSچN O)@18!@Wp0Q*  B΍@0P@lȝ W^(0pj @0 R nQ40PbU:dR8 T@:@΍l@P΍lX80cS Q4@\(bQ :dRX(^PRl8`0 ^ll h3hC/`Q lq@Plhd4 `R` `o V1##>pP ld@P ph @PPeP@lU@1 u @P PhH@PX :h@Ph8`ȝ(h^,lhȝ0 P0 h84hh@Pkh@ "@Peh@Pah.@(h @PThȝX80@S @PHht@PDBnN`Fd p] . RP PPEKHP&P@ p  p ;H> ?@@BA2H \ x0lP. +h8S ΍%BAH@BNHtЍۍO/G\Th8eO-QMP@ <4R 44 040ğ/T  4ğ/ 0 #P@ C#0@CP`,4^C @ 3R l 3hß/Y <P  0h030C/\8 8   C@P  @Pl @P0 QBz @PvO| x0xtx^Xh00 X X T"(2 $"0C"@OXtP` |0PP'\pd[ P!0P!   PP -\ \ @= @@H!1 @!0\P@  @Ph ^  t 3 8<Q @ h0<Q R>0 <0\H[ ЍO/DSNDT,8-U 0PP  `dPP} PPuP@TDP(0 pCp p͍ PUl\hEENGF^0 hč@pčlčYPP EF0  pxPPFl3oᗨl+ 7@  3 @P  Ѩ@AFTo T PlP PPF ⑮G UE=  ^YpPH4L$SR R :$R  7W/^ 7ǟ/8 "YGPCpx0A G~ x R  $R <ĝX a` TPX0X0BY   5t/` XG~!`0T`G~X<`PX<4`8čT0`PX`0>A^LP:$X\T0T0 P ,P L4(/T $$TQX0X0 4S  4s/ĝXPTĝPTPtXP<4SX<$8T X4<4f$8 XPT0T0 Y <l h38s/$T$TQX0X0 4S  3R/XčTTpX<4SX<$8T Xp4D88po@AP XYT0T0  Q 8t L24Ÿ/0T A^P TPX0X0 Y  1/XAP T 0 WX  <YA.X<4 P8T0 X <%@T` P5H$L$@TU U-DTUP U&8ĝ\(($!$0AtC>PP4S  0/$R t |0p/CEGEEGJG|ЍۍO/TL\TX,8Y|P <\| `p@-@PP 1R  0/U P  0`/ `P oQ| 0t/0^H T0@/VP, O@p@/lbTK|88b,bTA-`Pp @1R 8G 010/W Q   1P/X 0S  0/P@T:@7T PU R Hdd  B0Q0J< PA/lbTK8doNK&@G-PPM@0 1R  1/hP 1a/X P ` d1Xq/ pP,8!  ! 09`P. @T 0/ @咈Y庈Z @T`0^| } LR PAp r@TV`lPDD eЍG/lbTK8P4p@ G-PMP L1R D <1</U 1A/ @ 0Pp0  P $ ``" I:PPp @  p 0@0 $ $`  P@P T  0ЍG/lbTK8XhdoNK@-`P M R p1R h `1`/@ PG P04!P 1 q/ 0CQ \pppp3NQ  P| W 4 0S00D\  $ 0r Ѝ@/lbTK8h@A-QMP 0S P 0/$ R0@P`) p  0i<`P` `P| P `@^00<lH G24r$ 0!ЍA/8܂ lbTK0@-@PP M h0h@ \ ^ T/uPD 0 Ѝ0@/doNK8@-$@$0 Sc@/8C04C0/ Q^* Pǒ \ @T 0/ dG dǒP@@ d7@P @Ql' 0l'/ @P` 0D2 Q?Ѝ@/@ 8xtcLL(O-IM@ d,P0LqP`Q  0S  3ß/Y 3c/ Rh||3h/ RD\3Dß/ R @@3 c/X$ 3/P 2Ÿ/P 2b/TX1 T^S  X2X/4"!>[`P D8/PtT@ T ( $2/"2  202U 00$P(0$P$ ZPPO@(P,P:P@PAP$z$" p, TPL0pHp4pLp8<@DpR H >Ο/@l@DP ppDZHZP` <8LP\tx|. @`(.΍00,$P ㄐ 08P00 @

 <2S 0 P PPP , <Q QR 44$4T S$XX$44TTZ>p@n$ 0$PP# "U UU , k$ 0/@41 9S, w <–0\85<2@RLP% 0/@4 S $,0^ <^5<2@7% 0/@P4P yPt@Tl% 6xPUl&86|\ l4&=PL&ll6p@$ 0FPP/ "Uxt|~ UU- ,* <2S@⥎PJp $0PP' "Ub UUc ,` <Q<2@. 0/@P4P|@@ l.>P| p> $0+PP' "Ue UU , <"RP 0Q4^. 0/,  <HPPt><2Z4\L0H0 \%R ETh8>΍PD"K @@,P G,(\.=@.=? .@0ST? P= d-#)t\. 0N@vPL*Pʝ R *t$ - 0/\>P|00: v^> PP |@@, 0/% 5S S S S 'S S5SS S |BH<, 0/PP )ɍ)ɍx ;P ;Pv L Ჸv္|vhK@J0  P,(0S $P@N +@l 0/Tv ~MvLHv4$P@x*i  <% @$0ku@$P DD*Ta ⴅ ̍Kᶋ5(*;HR@@(΍,J0Q̉(:KN.0D N 䉍IOɝ\90 )R h d9dI/ Q90 9΍ S  9I/ X))0ʝ L:@T*&PPPU P /P @t 0/UP L84ȟ/0S 0'`8@T 80+88\ +8 U UU , `W  P@ HD XTp 0SrpP Pj (P< Q P @   IPC @^P⡮T pt7N0 0H P PPP , <"R PP *I 0l /U , <P@4l)MP 0P\ PT\ P %RX,@} p^ $0PP" "U UU ,@ <2S  oPG -=N$,0 U UU  <^%-<2 @0@P4P00 ̍P.PL 00S14 R. LUU 0/婗H  0H L4 ),@L 4H " 0/,L <2H@Sd=<2PU4@TL0H0 8 R , 0/8@ L.Q@^, ΍ P ,@XP  0/@ \5SS< R ,@(Qt 0/<, H0$ S:lHp < P%Ul+HP@D@L@ P- R00 @:S d t p;p˟/@^00 < P  , 0;(˟/ <*Z000@P\< l !16 Ppd0DT@!PHX@0PW `)H 0/0Q@<00Q&Q$Q@@|@0S S 6P .PATЍ@/rdrO|8G-`P p 1R Y 1/ W W   W\0P/ ^0PP$ ,@  P\dd @`.屠岐q 0SQ P PG/rdrO|84@-pQP M< 0` \ @/>0| a@P0 00H`P D0 G` 00@ Ѝ@/t|8rdrO0@-PP@M 0K ^ /TL 0|/ \TM`0T/ |(Q80$/PЍ0@/LRes8dk,D0@-PP@M 0 ^ /T 0|/ \T`0T/ |(<<0$/PЍ0@/`vrES8dk,D-MЍ/0@- M0  #@P 0\:00Q0S  0R@@0  @0@@ R@0 @0@ Ѝ0@/0@-@PPMP L0L D ^ </P00Ѝ0@/=vrES80@-PP@M pp0p h ^ `/T<L H0</000Ѝ0@/IvrES8J\0@-PP@M` \0V P ^ H/0 @ @ Ѝ0@/vrES8p@-`PP xx0Y l ^ d@/UDP L0@/ 0@000p@/vrES8e\0@-PP@M` \0\ T ^ L/0 @ @ Ѝ0@/svrES8p@-`PP xx0x p ^ h@/UD L0D/ 0@000p@/vrES8\0@-PP@M` \0\ T ^ L/ 0 @ @ Ѝ0@/vrES8p@-`PP xx0x p ^ h@/UDT P0D/ 0@000p@/vrES8\0@-PP@M` \0\ T ^ L/< @,@ Ѝ0@/vrES8p@-`PP xx0x p ^ h@/UDm L0D/ 0@000p@/vrES8\0@-PP@M` \0\ T ^ L/0 @ @ Ѝ0@/vrES8p@-`PP xx0x p ^ h@/UDT P0D/ 0@000p@/vrES8\0@-PP@M` \0w P ^ H/0 @ @ Ѝ0@/vrES8p@-`PP xx0x p ^ h@/UDT P0D/ 0@000p@/vrES8\0@-PP@M xx0x p ^ h/TDT P0D/0S 00SЍ0@/vrES8\0@-PP@M ||0| t ^ l/THX T0H/Q0|  W^0Ѝ0@/IvrES8Jt0@-PP@M ||0| t ^ l/THX T0H/Q0|  *^0Ѝ0@/jvrES8k0@-PP@M ||0| t ^ l/THX T0H/Q0|  ]0Ѝ0@/vrES80@-PP@M` \0\ T ^ L/@0 K@ @ Ѝ0@/vrES8p@-`PP xx0x p ^ h@/UD L0D/ @0@0k`p@/vrES80@-PP@M` \0\ T ^ L/0 K @ Ѝ0@/vrES8p@-`PP xx0x p ^ h@/UD  L0D/ 0@0k`p@/vrES80@-@P MP 0R  0/Q x| X0U |4 D0P | ,] Ѝ0@/vrESu8y~0@-@P MP 0R  0/Q x| X0gU |4 D0P | \ Ѝ0@/vrESV8Z_0@-@P MP 0R  0/Q x| X01U |4 D0P | \ Ѝ0@/vrES589>0@-PQ@M 9d0dd/P ;0sP 0 400  0Ѝ0@/8LRes0@- @R MP0 8, ,0 00 Ѝ0@/@-MpP@4` ↞AR\vO |K\J0  0@P0 ,0P@ 1!f@P, P0D@P, ,0 Ϡߍ@/ &p@-PPM 1/ R |C1|A/ R d1R DX T1@/@ R441/P@UP6`^ 0` /0S I0/`PP`` DK/ , T0(`Q h| 00`M 0Ѝp@/ 8vrES ,1p@-@PMZ 2 Ÿ/ R [1Q/ R 1R \ 1/P R|a1xA/@AT@Q0XS  @a4o@1/ R s$1/ .@T00 P x 0/  P00  0S |x 0t/  0000 @ R~  0Ѝp@/8LRes`p@-pSP@`M0 / 0@Pt 0 pZ 00`P 0@Ѝ@/8vrESp@-`R@Ph0dd/0 S S 880  (/ 0p@8p@-`R@P0/T t0R \ `0T/ @ P@T @p@/\8LRes 0R/1/G-p@`A`p@1  R& ZT! dPUxw p0p/U T Ph PDU*, ,0$/UG/\h8t0@-@PPM 0 ^ /Ul p0 \ X/ \0<00/00@Ѝ0@/\TSLP8<@-@PMPp 0R  0/ U``UPP 0/ P  bQ  _P U0PV 0PP  LR ( HЍ@/TSLP\8\p0@-PP M  1/@T 0R  0/ PӬ0՜P/PAUPPQ x00!L0P R0 00HH BϠ 0\ Ѝ0@/\8TSLP<@-@PMPp 1R  1/U`` U  R0/ P  àQ  P V   0S 0 1YN D0pX AP ( Ѝ@/TSLP\8\p3 A-@PMP 1R  1/U`` U  Rtx1pQ/ P HP!lQ  iP 0V00PP02QP 0pPP% Q 0!X !0$  pP ᲀVP L0WP 0AS 0, !ЍA/TSLP\8\p3 @-pQ M` 0S N 0/ P0R@PP 9PP Q0 0`Zd [ @0 PPPP$ @ Ѝ@/\8TSLP@-@P88 40 , ^ $/@/+X`+TBR80S 0S 4  $ /0@-@QPM 0/0S |0p/,3  Ǡ0 0!! ,0!Ѝ0@/J|\X8Kp@-P`U  35@T00 \8/@$\  000p@/8X!p@-`QP 0/@T 0|/PQP0 @00   R@@@p@/X/(82@p@-`QPe 0/@T 0x/PQP0 @00   R@@@p@/X(8S@@-@PDD @0 8 ^ 0/0404@/ XX-0-08@-@00@/0@-PQ4M@hh d1d/ R@LL1@/   (1\  0$  ( ,   cT 0/,3  Ǡ 1(",1 0 吾 P @ @ 4Ѝ0@/XV|\8WnSND]@-14MR 0$ p  (,P  P 1, 0 0 7  Ƞ,<,1崼P 3@P@@@ @ `@ à Ǡ  , Ƞ,,  P0VA `F 4Ѝ@/nSNDp@-@PP` 1RP 1/ 0S Ĕ\0,0 R 1 $ 0 R 0\  E0S   4 CS1 $ R00 RU0 !à0 0 Ǡ0 0,  8#,, 1P V  &P D 0S 0p@/-0-0XB 8@-PPM@p` L1R D <1</V000S? T- 1#7  , 8#, 1  P 0/ 0@ A 0W $R  Ѝ@(噻Ѝ@/-0-0XX84\ @-PQ@p`M 0 ^ /T 0t ^ h/'P 0o80P Ѝ@/ X`+TBR8X -0-0@-PQ@p`M 0 ^ /T| x0` l ^ T/ 0400PЍ@/ X`+TBR8 X-0-0p@-@P`P 1RP 1/0S  R 0 0S   G PE $1 Ą 0S PU 4 0/U A1$   R  RQ R  0PX 0p@4S p@/-0-0X8 t0@-@PPM HH0HH/P /'T00Ѝ0@/X8-0-00@-PM@TT @Ѝ0@/0@-!KM M0,4]0Pč@ˍ @DK404$$$$$$$}+㏿iTЍۍ0@/nSNDT p@-@P`TZ h1h`RTU TNT RV PU >TP 7T)ST `^ +T S T S00S x_T  0S  DQT P@LTp@/DN$8Lp@-@P"< 80 0 ^ (/ @yX`+TBR8A-@QMp` Pᬀ0 /0 0,00 ( $峕 EP  о꿬0( TލA/sX8nSND0@-PP M@ 1R } 1/T5 Q P.Q P& Q P $P 0S/E 8L#,,# 00C Ѝ0@/+TBRX`8E-P Mp PU 1R@ aE 1/PU@ Q  1/@T@5@0S 0S$P 0S/`\`V` ^00 0S0 08 #̂,#0, W@B@ pW`@T!^ G 0l/Q  >0!@0 @I@ 0@ ЍE/+TBR8X`%`-MjP  Ѝ/ tXE-Pq%\&O-M MP  0倘儸 (9R  9ɟ/ 9/0S ^  8ȟ/0 S 8吨/Y (@@D" K P jNPxb>-@P C M`ƍuVVFFF FF F$F嶒EO `F  @,tHTLT0D4D8DU, @.0Pȝ\ 0S, $   P! 0/  0PP P  X/*pPKP ? \ЍۍO/+TBRX`84\tnSND4Psp@-@PMP` 0R 0/ 0/ 0 fP$0S  0PЍp@/+TBRX`84\A-M0p W`P@ 0 ^ t/0  -0S $0S 0ЍA/X8O-@ 0 MS0: 0`ֿP`#  pQ:p 3+  0PPUp XX !@0= ᬽ +  0 ЍO/XO-p M\` 1 A/ pXp l1@PX/, H14!x @P,0= 00000 (0(00(Ì010(0(89 .ʠ70(ppp p$pp p0x10lM(" , eM0@0 ЍO/$X8(\O-M MP  :R   : ʟ/  9I/Q PU  9i/ᣎ@΍.⠹&]` 0 P9匹iiiii娉嬉ii3I^ ;P8    00@^[p"-~  強ggggg؇܇ggiN͍a> P A wV쵍eeeef ffp 8w/ O.@͍^ 0 A p<ܻkkkkkll d$d(d,d4d8@dDd04庎 `4D ` `pA, +ˍ1&]H$ , +彎; P @ >KӯP@ P <S `<P! c0 R ` \  (vL6(/4n !`{PP z 5ş/Qe \͍ 0 e 0C㶮_.@ @De 0⬮ OPL P0  @@\ V\ 0@ @T,`V <P0Q<0\@ca 8ǁQ.L,'K+g 7AfPcÁ k,;SQ.l pl1kč PP00PBN   @Nk0 6 <)S<0 &  c0 $QY\ LL H3ß/^Q  3Ÿ/P p 00PT \ | 2xŸ/P P H 2DŸ/P0S h d2Ÿ/p  D TQ 0 U[XP @;"Q 00PU+kP @000& P,U @T  ,m 0/ 00  p&͍  P8 ЍۍO/+TBRXu`8v4\wnSNDDx(zX|@-pPP@` M0  ^ / h ll0`/ p"5P P$0S $` Ѝ@/`X+TBR84\E-`P Mp0 (1(/W 0S  0@/z3X  R0/  0@P P@  `PPP\ l0 P ,IP00@ 0券 ЍE/XtZ8,+TBR0@-@PPM ll0l d ^ \/p0 S0@@04/pp@Ѝ0@/dlW4DBR8Y0S#3/8/0@-P@PM0   ^ / \Xdd0X/8\D @0(ࠑ/@Ѝ0@/ld4DBR8@-(@:#^(0`@ ʠ,ˠ N.D@@0 \$,,0 ^$/@/d(88-|0/A-@PTp`1 0S 0/ < 01 0g0 $`0(:0,0 0 4r  0P0890A/dp8$60/-0 'R 'R Rd0 Q//@-@P\\ X0 P ^ H/ ( 000$/h@/dl4DBR8H,0 0$RB4 400 /00S C 400  $04 /,0 /p@-00@sP`|| x1x/4 R0000(*";P $0 ,1 /("0ʠ,;!0Q4040(0  ˠ1S  0/(4 :#!( 0 4 ,` ʠ,;Q@0@0(00 ʠ,;4 :#+Ap@/dt8-M0 <,0: 0P4 0800 Ѝ/dZp@-G `TP& 0 S0/2`ʠ,; 0l 0SP`0翏2`ʠ,; 00CS(( 0篏p@/d 8PE-P@U M  0p `/` *" 0l0Spp 0燏0 2`ʠ,; 0 0CS,, 0t ЍE/d{8~@E-@MTPp  F `2 !+ ` ``0S0 L\@!( (0S S 0 S 0V  V@T@T !+ ` 0CP(00 T@ЍE/d?i@E- p @*"ˠP`` 0P0PSM0 $@ \ 0 U U0@S @@T2  +` 0LS0$(( ΎT@ЍE/d@@-PPM`  (1R   1/V P  0@/d@T! p ˠ` 0S0 \2`*" 0LS0Xtt d  ,P L0(/Ѝ@/4DBRdl8@-PPM@`  41R ,, (1(/V P  1p/ p*" ` 0S0 7(0#6 0/(  &(` 0\/2` ˠ 0BS0HH @Ѝ@/4DBRdl88PD<p@-@(0M` P$`"4`0`Ѝp@/@-01pMP`H!-@L0SL0 ҍ R0/T @# (!6 0/( :#&(0| 0/ ` 0S @@ @L@\L@@ Ѝ@/d \ 8D<p@-PP` 0  ^ @/Lx0S L0q@ P\dd0P/ ,L@0LS8 L0[@p@/dl4DBR8\A-@RM = <0`tP P\\ P/V@@ <0`0!0 ЍA/8d35@-@ MPp |0| `h0P@ PPP H0 Ϡ@p  Ѝ@/dp@-@P`  (1R  1/V P  0P/Q  0/L0^L nj Rx   H0PP  PL 0BSL0$HH UPp@/4DBRdl8T(\P@-pP`P M0 /U 0@/V 0p ^d/@uJ 厃⚀H(0 J00 Ѝ@/tZd80ehE-R M`0$(@,Pa 0tW 1/00 @ ˠ` @0S00< 6R!KCR3(0 R H`X$  3@$@0 ($ ( RP=@ R R@@T0Sr [) ,@㺛   I @宛  0㐤[00Y0,`S[0H@\ (p倰6 TQ 6 J0  Q$ !$P KQ00 20 R  *& P & 0 CR lt |3YP I p@w \ЍO/ds .  O-(4 MSP  1/ :# p` @P|!ԃ$@ p5 6RKCR+(0 R  H`W$ / p(@(@ 'Rpp R0pp p @TZ @T  W $(,T@0L@0CP88 { ЍO/d 8 .'T O-2BMʠ M,`(` 0 ,3$ R P- (@$6 @@@6@Ɵ/(0C!FT( P 6ş/0@S0 5ş/t3c( "6 5ş/(0C!&R(Q(PPH$@Pp P U$ t@T YH0 0L[L|L $L|0@SL0|$ۂHY \ 4XT/$Pd$@p ^ğࠁ/0 \  0 Wp(@T 3  @T0 [@$@$  P @ P : Rp \,ßࠁ/ @ T8 43@Q 0  [ $    P$PUP(( 0Sd l2`Ÿ/0CQ,x <2(Ÿ/$ R| PyPX PDPTPP@"*t3X) (^PUEqP (+@!0`+ P+ @"pl!0 (.0Sq < 81/ 0\`` 0 0`PP X PP D ́PQX PP,ЍۍO/dD8@d\t-@Th @p@/d8p@-'PR0/ @T0So$}/@\TT T    }>@T4 @p@/d8G- @MTTP``0SW ` `  }>q@P$}/0w@PT@ @ЍG/0@-@PMP  0R  0/LPLXdd 0SUAL LRL ,, Ѝ0@/4DBRdl8\O-XMU`c 1@0|!P嫚@T00PᇿPLLL!@P P$,,!vw `P J$;^d 0 0C^ U[  ( KP\|| DP0 㬾P,TT 800ЍO/U >Ο/~j8`V0 08Ne ^j}8@x`<`F:G΍ @H F  $(WN^p8G rs-~j͍8P PHj=8@P,P-xjM8-@P `@:j*40-PP.$@(xp<G(TUʍ* $Q j8`JP㸲 !{ ` 0S0   -xx<`N$ \02  R2 `ʠ,` (`pAWp( ,bx j}㍏_M@+b `ႏb (D\rᩏ 0^`P @o_ 0PPUVxp80G`Fj}\1UN(@@Z $ P@ _j]00PPWJ p`*"k  `0S 0 +wx0z0D 0TzZ܋j\ʍ庑P" 0(`f T(p@D*:jT"z'ˠ P80`PN\PP"tx<@RRʍQ (pWj- 80;xp<G ā:*0[ j Bz8:ʗ 0YY j=ʍ8 z 0L,Qz Sʍzj-s!; 8` 0@S0 #.tSj=s8 P'P# tx< N Q% (D*Jj͍j8 @&;`@ \DPP$tj-80 0CP$s P 80C Zzz@$\Ix0<C \x ,BߍۍO/O-`P,MpP  3R  3ß/H <0lFPP@408P 0!PȀpXpPP0 p0 P$P,P(`ʠ,+0^#s  P$p H`P !+ 0@S0"vsPPU pWmPj 00e $0  0R4R7 $ < H0{CPP  H$@ P$P$1U HHH@PPG    ,   $ ( H/ 0R*, (1/[@$@p@(T0 u 3(0\ R  HrPT 02 !+` 0LS0 (X@ rLP,ЍO/4DBRdl8@C@Cm@-@PM`p  0R  0/H 0PP' @XL 0SL0 rt d| x0`/L t0BPtL(HH rDPЍ@/4DBRd&l8(2\5$82 A-PPM0 `  1R  1/H!1寜@Pj   0 S QՐՐ1Հq/  0S0Ld `1H/P  44P ` 0 0pp"`p! 0S0 r( 6 0p/( !&(p 0l/pp2`!ˠ 0BS0$dd q(@ЍA/4DBRd3l85BCiSNDP6RTLU<Y@E-`P MP@r  1R  1/T 1封/,P,h  (ˠ` 0 ^ Xll!qW$ @.p,0Q K?CQ00( ( 0 0S S S Sp@ RT 0 ,0vW 4 ,0m BPLhh eqT QDD0  ЍE/4DBRdl8h43@- @MTTP`pp(0S"ON$ }?&xPP  }>@PE P 44 000/@ @Ѝ@/dMh8@- @MTTP`pp(0SO]$ }?(xPP  }>~@P P 44 000/@ @Ѝ@/d&h8A-PMP`  L1R DD @1@/  ˠ`0^!p(0 *"#6 t)$ R @ pk) c)@T W@ |)2 ʠ,  ` 0BS0 $HH zpX)ЍA/4DBRd.l81xP@E-BMMpP `  |2R tt p2pŸ/P  A @T& A  PU00*RPX 1 BZ+AP@!0@A  ;`@T@h!p$@?0 KC R X((1 , 000!8C0%Z   u0 ((X @ 0 QX  L0@T2 ! ` 0BS0 XX o$ЍۍE/4DBRdl8nDD r  ! 0\0T0S=D0S  :#\ ` 1X/D  :#D R00" ;^  1/D  :#DDTD  :#D`*"ˠ 0CPP~ m ֬P0p@ mD0@0LЍO/4DBRdl8  P , @-@Pp`P MTT P0 H ^ @/`P H 0f Ѝ@/dil4DBR8$gA-0CM`  P00 RQ7ǟ/ R p/ t7lW/0SZ pW8H D74ǟ/0@S0  7V/ Q00 pW  6Ɵ/ P00 0S l 6hV/p0   \ D @6V/0vH 5p p40Q-Q00\  5ş/ 0 ^00P H| |5Dş/ 000@Tp\PW: ^Pd000\_ B., !PJ0S 4T/PU+ B@cT/P@@B΍B/0@TOP P#0#<$<#A44$0@姆@ QH, $ 4@lP A~P@T d 3`S/ PNlX @K P B +#l$D3 `C A<#40i@3PH<P@`^Ÿ/`|0S0"00lP @\ PU 2:PU@@\ R/\ T |2:H!1 M@Q@@\Q/\ T 2: BHh1!@Ғ00 R@cq@\ T:H!1归h^h\ 0H`0@孒`@PpPU  D1@/ RLP0L0l6 !kAP@<PP80H @CލA/d` 8(   H     0C@B `!"pw`Pb@t````x@|@ 0Pp RX T2Ÿ/p0C^p , (2/ v`a```!00 lPQ!\ !<1А0S@\_o\ T@h!0帐Q \08!0嬐 hPh \ `l0坐` L R0L0D i $0劐p`&<ЍO/d*455J8LXdu v x @x P p DSND4DBR   @-PPM Mp  1R  1/W P 1A/` B` ˠ @0S0L``!Ki 0P `V`Q`` 0BS0!2iV. L@PL &iL0l C@BQl@L iT@P +ڌ!||x x0P! n Ѝۍ@/4DBRdl8\-E^G. p` ( `$8dn @ ɍ} a}Mf.n^  P} qa} H>`P @28 .ˠ ` pW4 p|(Dfpi$@`6 R KHR-(.Q8 HP"V9$ 8@ i(0(0  P /Qp Q` @TW 0*`P j 80`Y $ʝ 8080g90Z` H H`4 @^&eV \QVd `dV $* :8 j$ʝ*:8@`OPM䉝 8 ./[[`000#@T@%e9 $@.P0PP$`(`,` `j :R"KCR\ɝ(.pW8 HppU9$ 8pJP Ip(0(0@P9 R [XR R Y# ,\P$#0RP$P R 0R RP P RP(P P hRP,P PPP@TX `BV`Y <Y 0SʝS5 2 0S% JT 8Z J 8<6@ `(PP^<&V $08( ( 8cH I0CP "dQ 8)ʝ  ^`bb [[ R`V00[0SŸ VD 8<6P$@ PPT<& $ʝ08$ $ @b@WP 0AS000 !ld ^Pt!ydU <&; T <&9 0AS0h4!ed8PcPHH!\dX$R) `$ @)80Z%`@\ Hd 80@\ L 8d88HE{ߍۍO/4DBRdP8 &./ex..Y34 O-`PM0   6R  6Ɵ/P00Q H <06@Pp408@P XȀ@@0 0币 @往$@PR(,P0@Z 000  P THPz 77  0 9P<LL%c4$%<5P' z0,@0@ :@P0  86@P 0@,  .6@P  ̀弰0%7#7PP @T77 H ! P\ PġP$Pc @ Z%+`0^#>chP @ J0 XB) ʠ,[P唐g@P: KE^6(D0 R ( $3R/ P( ((( (0PUZ 2Ÿ/(X( 0x@!;!@TY5 (0D"PU < (2Q/ IP(00( ( ( (PUZ 1/(zX( 09@+X@@T P㟡P XX!bQ0  @0@("PpP3 0@ ! 0 0`0 CR  ubX PrPd kbP00S d꼀 ЍO/4DBRdl8@CP$cRx@E-1LMS@p{Pao ,zP Qad `P_H ``"?0P0PQ`QS @8yDXD@\ 2 ˠ P !"H< <04PP6<@ 4 0 8P gaP80``P 0 P$P,PD(``P PD h`P D@!P000$V`LЍE/@C0@-@PPM ll0l d ^ \/p0 S0@@04/pp@Ѝ0@/d0W8DBR8Y0S#3/</0@-P@PM0   ^ / \Xdd0X/8\D @0(ࠑ/@Ѝ0@/0d8DBR8@-(@:#^(0`@ ʠ,ˠ N.D@@0 \$,,0 ^$/@/d(880-0@P00/A-@PTp`1 0S 0/ @ 01 0g0!$`0(:0, 0 0 4r  0P0890A/dp8t70/-0 'R 'R Rd0 Q//@-@P\\ X0 P ^ H/ ( 000$/h@/d08DBR8H,0 0$RB4 400 /00S C 400  $04 /,0 /p@-40@sP`|| x1x/8 R4040,*";P $0 ,1 /,"4ʠ,;!4Q8080,0  ˠ1S  0/,8 :#!, 4 8 0` ʠ,;Q@4@0,40 ʠ,;8 :#+Ap@/dt8-M0 @,0Q 0P8 0<04 Ѝ/dZp@-G `TP& 0 S0/2`ʠ,; 0l 0SP`0_2`ʠ,; 00CS(( 0_p@/d 8PE-P@U M  0p `/` *" 0l0Spp 0_0 2`ʠ,; 0 0CS,, 0_ ЍE/d{8~@G-@PT  K 00`p !;` P c_ \@!( ( 0S S 0S\ 1X 0X@T@T !;` LP$,, 0_T@G/d?i@G-0 0 pP`p` *"; ` @P  _$@ P\ 1 W 0W0@S @@T !;` LP $$ ^T@G/d@@-PPM`  (1R   1/V P  0@/d@T! p ˠ` 0S0 ^U2`*" 0LS0Xtt ^d  ,P L0(/Ѝ@/8DBRd08@-PPM@`  41R ,, (1(/V P  1p/ p*" ` 0S0 H^(0#6 0/(  &(` 0\/2` ˠ 0BS0HH #^@Ѝ@/8DBRd088PD<p@-@(0M` P$`"4`0`Ѝp@/@-01pMP`H!>@L0SL0 ] R0/T@# (!6 0/( :#&(0| 0/ ` 0S @@ @L@\L@@ ]Ѝ@/d \ 8D<p@-PP` 0  ^ @/Lx0S L0]@ P\dd0P/ ,L@0LS8 L0l]@p@/d08DBR8\A-@RM A @0`tP P\\ P/V@@ <0`0!0ЍA/8d35@-( MP` 0pz0P @ `bP( H0 Ϡ@$  Ѝ@/dA-PPM  H1R @ 818/X P  1a/Q  0p/L0^L \  \ p ppH`P p00@0@`L0LSL0(LL \V`ЍA/8DBRd08T(\P@-pP`P M0 /U 0@/V 0p ^d/@} SPH(0 R00 Ѝ@/tZd80ehE-R M`0$(@,Pa 0tW 1/00 @ ˠ` @0S00< 6R!KC R3(0 R H`X$  0@$@1 ($ ( R\B@ R R@@T0Sw [. ,@kѴ  r a @8Lk  0tI[00Y0,`S[0H@P p倰 6/ R 6 %1 Q$ !$Q  KR0 0  $T0S0 T& P & 0 CR t Tp3Y\ pIGp@p{ \ЍO/ds .   O-,4 MSP  1/ :# p` @P|!S$@ p5 6RKCR+(0 R  H`W$ %!p(@(@ 'Rqp R1pp p @TZ AT / $$,0T@4L@0CP88 kS ЍO/d 8 .'T O-BM M)`(p .3$0S R- (@$6 6Ɵ/(@!FT(0^| 6tƟ/ AR DT P6<Ɵ/t3( 6 $ 6Ɵ/( :B#&R(0p(^PH$@P`P 0U0$0 i@T  H00LXLB H%$DR뀀L NRL $$%RH 5T/$P `$`@`%0 S  Rx 4pğ/P0^ !` [`  @T @T 0Q 0A?  P@$@$ P  0@ S:^: R` \^Hß/ @ TT P3@ R  0P0$0  P P$PU{0S(( R| 2tŸ/0CPD P2<Ÿ/$ R| QyTX TDPT㤐PP@"Qt3X) (^PUEacP (+@帶!0pl ڷP+ @!0k ( >Pq P L1/0 0Rpp 0 pT^ X P㪐P \ QTQX PlTL 倀,ЍۍO/dD8@d\t-⩳@T @p@/d8p@-'PR0/ @T0So$}/_@\TT T    }>u@T @p@/d8G- @MTTP``0SUڱ` `  }>?@P$}/0E@PT@ @ЍG/0@-@PMP  0R  0/LPLXdd P0SåUL LRL ,, {PЍ0@/8DBRd08\O-XMU`d 1@吰0!Pyj@T00PUPPPP!NP@P 㸎P(00!DPw `P J$;^2P 0 P0C^ "P[  ( P\|| PP0 yP,TT P00ЍO/ d q6$PUW- [t 2pŸ/ R0P PU$P <2 Ÿ/ PU`$`p`( 0R(000$@$`  , R [ 0 S4``4 80`RQ9 $P/ @\0S \1PP 8#8S.S,8/SS S \ 0S1PPPh\ l0  P P PR<ЍO/dx8eCGA-M@pY 00@ HP80P!!<P!P@`U P@ `. ,  /0@PP `nHP  P@ o @Pl i @ЍA/@-PP M`  l1R dd `1`/V<H D18A/pP   1/LQL Lt0 0@/t   0/t0L@DPtL\ eL dXp@@H 08s Ѝ@/8DBRdE08FH(J\L@M`R]G-`PMpᰃ  1R || x1x/WP .WXPPK H@P@F  Y (PQP$P 0  P P0P, p! `0S0 K0  @@ PPP2`*"@ 0@S 0L`` KTYd@ЍG/8DBRd08@O-pP4M   9R   9ɟ/ P( , P8H/0@CT@ R L\L|(K Q `| x8\ȟ/L 0BSL0 ,PP(LYL 8 (~K $P Q `V 7ǟ/0U  7堗/` R pj7pG/@Y9\ 0R @T X T7ǟ/ P00 Q   7F/00 R 0 0 \  6F/  0S@8( 5 R.X00 \ ` \6Ɵ/Q 0 0 0S  6ş/  ,0S @,(@ ,@@TY@Y@   R  00@0 0Px|0 R  0 ,5ğ/Q  0 (  0@000t@U5 Y @ P  Q| x4 ğ/ 0R Y( K@)Q@  R    00@ \@ T 0S < 38/$@@ P00  R l h3Ÿ/Y 0 0 0S $ $3Ÿ/  L0CQLPt"J$ R\ dT ^  2/t20H( 1p(Pg PWP88"I(PQ@`"  ; `V``P!I!|Y$ \0 S101 ^ \101 RQP(00(0 B BPp!IQ PHL0spPU㌈P $ I004ЍO/8DBRd08\PC @(2?BDxG-@PM Pᰣ  2R  2 Ÿ/U 1a/ P  p !k ` 0S0x!IZ 8$ P.0S 0S19 R U  SZ0P RZ 8 0U < 0" ! `0 CR Xtt HY  Z 0SPЍG/8DBRd08h@O-kM MNk] /P ʀ >Q \>Ο/~k`V $ H  B$X>k͍p H``F] H @PD$@Kʍz$Hp $(,_= C_`~k-PPHBk=@P徆P,-JHkM-@P `@:k]*0⿯LPPB( @,HpG,[*7(Đ\ k]j JP pj&ˠ` 0S0L ,H$ H0 pW\a<  R8 b pʠ,;` (`NP @@,G jp__M:(@;b͍`_b8 [|B7_ 0gPk  !iB(`H p @6^_-( 0gPjUW^pGU*͍0(@CzZ呫P P@ _](k=!PPaʍ: r`@ k`^( +GJ*H$@ PpW1 @TLQ D*nGT *} _H(B@( P- idZkm$@`^̍8^f- 8^ ,~^p[=( AI8@ ^,p^PM AQ͍^ ,b^p< MAP ሰ^4E4K)͍i-Q=jp$4@ z<0⦩PM * @2`P+{Q |(GZ H$@ ^pW @Tr .[ ` 0@S0(FT - 4KEGPP PI=i Q8 $0fPp `8`pB= jiQMZ4B$ <0ʅFPI:* 㸲` J$PUP(&F HP$@ \^ @T  .ˠ`0 CR &FT ]4@ ᆨtFPP P iQ=,$ 0fPP P_fM(8d `̍ @ 80iaf-8@I W8 [cP5f<U8 RcP,`0 @Oa̍8_PDuUU8^Y k=I iM@0`D@U Z dPP000. wUuNH pNP@$ ?k ş @\  Z*;/PPSTtTPNPM( @,0H`F,Y ʍ0 dtk  d Q (@P@(@Zt"kJ/ZZ$ 0 `` ` `Y#Eʍ: h$@.Pp`xH40S \1g9@Tc P#$3k =H  Bʍ./Z:P,44$0D ZeXY00P,P\(0, Z R \R00S RPX VR( 0r03Y0S9 R (0y03X0SP /Rp R Q |R`4@TP 0PU :|!帲k ʠ,{ P `p0C[ T T!EXH@@D,Qk QI `P" p ;K\ DZ*{;p PIt8DBR 8' pY   d / 7   \ ../ E ]" ! `x  d \& [W#00S :` z'  AR hh D*k}P*;PPPPH@@D`w`3R`:S ʍ8* k 0S  ʍ :{0pY[ k 0[PM0P  Q0Q:0 0ZZZ SZ Hp G,PPW ʍ*P0SPOZ4RL ZRZZ &Z"HN0D@PA`B0D 0TzZY[j͍k*6aP( 0|8`f T8p@Dʞ2k Z% p ` LQ 0"DzH0C*;\S`S *R ,Qlk}: HA $$ʍzp[ k C: 0Y k}  00\:0DT k-2Hz'  0` A\ h$CTk=t P➂P$CH @$Q& ,2kj @&ˠ`@ ^%~Ck : 0P LR PPP%kC$ R H N ZZ8(\DH0Ap\4@gߍۍO/O-`P,MpP  3R  3ß/H @0PP@84$@$P(P$U H1H@PPL  Z 0 !1000 0$0(0, H40S  R, (1/[@$@0p0@(T u 3(\ 0R0  HPT 0G" !;` LR  (X@ OBLP,ЍO/8DBRd08DC@Cm@-@PM`p  0R  0/H 0slPP' @L 0SL0 Bt d| x0`/L t0BPtL(HH ADPЍ@/8DBRd&08(2\5$8` A-PPM0 `  1R  1/H!1 l@Pj   0 S &QՐՐ1Հq/  0S0Ld `1H/PU  44P ` 0 0pp"`p! 0S0 A( 6 0p/( !&(p 0l/pp2`!ˠ 0BS0$dd cA(@ЍA/8DBRd3085BCiSND7RTLU<Y@E-`P MP@r  1R  1/T 1封/,P,  (ˠ` 0 ^ Xll!AW$ @.p,0Q K?CQ01( ( 1  0S S S Sp@ RT 0 ,0W 4 ,0 BPLhh @T QDD0  ЍE/8DBRd08h43@- @MTTP`pp(0SO:ῡ$ }?◣xPP  }>+@P P 44 000/@ @Ѝ@/dMh8@- @MTTP`pp(0SOOს$ }?♣xPP  }>@Pc P 44 000/@ @Ѝ@/d&h8A-PMP`  P1R HH D1D/  ˠ`0^  !!@(0 *"#6 $ R @ p 0@T W@ |N2 ʠ,  ` 0BS0 $HH ?ЍA/8DBRd.081xP@E-BMMpP `  |2R tt p2pŸ/P  Ap @T& A y PU00*RQPX 1 BZ+AP@i!0@Y  ;`@T@h!?$@?0 KC R!X((1 , 000!8C0%Z   1 !((X @ 0 QX  L0bY@T2 ! ` 0BS0 XX 3?$ЍۍE/8DBRd082`!ˠ 0BS0Hhh!>ǔ RZPC @^N  P9 `V6Ȕ (W2` ˠ 0S0 >( 6 0/(:#&(0X 0T/2`*"ˠ0AS0P4 ~> G/dp 8PD<E-Mp U XX0`PC@gYVP M0P uPP0 `T 0 PE@:0ЍE/O-PPLM0D  3R 3ß/PPU |P#>p`p pD 0ᑥ@P@K  }P8HH#>[<T@ g|P#=Dp @P!D=D@\ ˠ., 0p}VP @P |P XxT |P 0T@"=@D` ˠ  0S0"=D^D r  ! 0\0T0S=D0S  :#\ ` 1X/D  :#D R00" ;^  1/D  :#DDTD  :#D`*"ˠ 0CPP~ G= F|P0p@ ?=D0@0LЍO/8DBRd08  P , @-@Pp`P MTT P0 H ^ @/`P H 0 6 Ѝ@/di08DBR8$gA-0CM`  P00 RQ7ǟ/ R p/ t7lW/0SZ pW8H D74ǟ/0@S0  7V/ Q00 pW  6Ɵ/ P 0 0 0S l 6hV/p 0  \ D @6V/0vH( 5pdc p40Q-Q00\  5ş/ 0 ^00P H| |5Dş/ 000@Tp\PW: ^Pd000\_ B.吡!PJ0S 4T/PU+ B@cTP@@B΍B0@TOP P#0#<$<#A44$0@V@ QH, $ 4@c<P AP@T d 3`S/ PN&<X @Y P B +_lcD3 `C A<#40U@YPHZP@`^Ÿ/`|0S0"0;P @\ PU 2:PU@@\ R/\ T |2:H!1 M@_bQ@@\Q/\ T 2: BHh1!@Bb00 R@@@\ T:H!1-bh^h'T\ 0H`0@b`@PnzpPU  D1@/ RdLP0L0l6 ! ;AP@<PP80H vjjoq@CލA/d` 8(   H     0C@B `!"pv`Pb0@x0|@0@0@0@t````@ 0P^PpQX T2Ÿ/p NRp  , (2/ p`a```0 0  l0PQ\!81:` R@0\>\ T@h!0"`Q \ 8!0`h0ShR \ `l0`` WxL\0L0D 9 $0_` <ЍO/d*66J8LXd5 5 x @x hg p DSND8DBR   @-PPM Mp  1R  1/W P 1A/` B` ˠ @0S0Thh!8 0``OP Q0`S`` LR !8V. L@TL@ 8Ll 0L@BSl@L0 8T@iVP +B\||x x0PR f Ѝۍ@/8DBRd08\-` p0  $0(`8dPU HPV,6$ uP!`01,FP(( a  R` 0R` ` @TY NX !6XƝ\ ,y,6X0`, 6Z dƝ, 6! Z! U 0CP00 <4!6^ !6 &, Z  &* 0 CR  6PuP {6<ĝ\ h 0d/0@⅗XߍۍO/  8DBRd8.XijuxzO-MMP`@ɍ8  :R :ʟ/T  :J/ P  R@HpJ΍G^@pD Ld$< X$\$`$H@M 0@PhM@E80PH8zP@vjtP )58pP @pn 0$*n` VH0@ `!#-ɍPM> u0M/M@go^LPq e0 MP ΍B 0J`P虝 80!+ ` @pW4@ p(5pi$@`6 R KHR-( 0S8 HPV9$ 8@!i(0(   P /Qp Ч Q` @TW m0$*vU`P  (z80p;Y ,ʝ 80288g9 *0Z` P@ ᥘ`4L^&/5V  RH6Vc ddV @pGp8@H. AA%`PVNY 㸂8.;/[[`P Y &4 $@.p0pPp(` `$`,`j :R"KC R\y(> R8 HpU9$ 8NpJ1P !Ip((@Q9 R [8XR R Y# ,^P$#0RP$P R R RP P ğ RP(P 0S pTRP,P PPP@TX `BV`Y <Y 1SS52 X% JT 8 ( @68= `(1PP\@&V ,08( -(!@cH IH^  #54 Q 8ɝ 0 Sabb [[ R`V  [ RVD( 8@6Q$ PP\@& ,08 $A @ b@W \ 0NS000 !p3 R X|!3U @&< T @&: 0NS0p^Z 2Ÿ/,X,@ 0@:#!@TY6 ,0PŸ  R H 42Ÿ/ , (0(0, (PZ 1/,X,@ 0@+XQ PpP ``!10`  @@ ``p`3 0@002  +` 0LS0 1X PpPd 1 RQ d꼀 ЍO/8DBRd08DCP$cRx@E-1LMS@pJPaq  JP Qaf p`PaH ``"喜0P0PQ`SS @HD寑D@\ 2 ˠ P !"H< @0PP8<@ 8 4 h0@-PPM R 2R  2Ÿ/@ T0Qhxx")0080 R 4LL") R000\\   2/0\ R000X0S  1/0X 0    l 1h/  @t p1</0 80NQ88!)00C^!}) r  1/(P  0/$Q d 0`/,^ 8 04/00Ѝ0@/!uqR8(H8\<`p@-@PP` 0R  0/ R0/ z4D2P84P  G;P8Q 0Kp@/!uqR8@-@PM T1RG  DDD1D/4 D  ?Q  0/ 018 0 R  (hP  <00! }h0 18 AR @\\ (,, (0(/Ѝ@/!uqRy8}0@-PPM 0R  0/ P l(,0S0X@,0 t@T R X^ P` \0H/]AP, I(Ѝ0@/MuqR(8$hp@-@M`0PT 1R  1 /U 0/00P (,0S @ }0!} 04P(04 0$ (4 LR ( 'Ѝp@/|MuqR(8$h0@-M@' P@P pZ 0PP0@S9 [  *Ѝ0@/@- Mp0@RPP` " ,0<0L Hd`` ``` `$`(`,`0`4`8`@`D`PPT`X`\``h``J(0 0PЍ@/< !!uqR@-@P 0R  0/ ,Q ,X(0S(/  $F' ㍠  $>' ㅠ$.@/!uqR80@- M \1PR@ LL H1H/T 0Q $ 1/  1/ 0080 R  '   , R ~0!80L^ HH &>' Ѝ0@/B8!uqR@-0  Q0@/018 \l|& h : 00180 0 L\,, &@/!n8otE-PIMp`@: 0N0$PDt0 *PP`V9t$@t@| u PP$tPP S@K@:P @6PGW2R tP P)$(P0P# {&PsP P _ ʠPHPɠ0 P2PPIߍE/@@-PMU@  \1R TT P1P/ @Q $4 01 A/ ,70 h@080 R  % ,@Tp`! $@P$@P\$ (-V 080 @R << %Ѝ@/!uqR8 0#=A-MP@p `᯹ ڶT@@X 01ЍA/A-PM`p U |0|| t ^ l@/$f%@ H0 ,P 00 0ЍA/P!uqR8 0@- M@PT 01R (( $1$/ 0 80Q ?%0 ^ Lr l PP   0080 LR << %a% Ѝ0@/!uqRE8hJYO-`PMp 帢R̲ 8R xxx8xȟ/WX7 X8PH/X0< 88(/[ 8ȟ/Q"7G/"R P  7圗/2S t7pǟ/Q Tr@QrT 0` \7(/H 0P0G 2@P2s3U^ PP,  0Ã@P42 &B$ @T@v y @0"^ 0  P,0R8>P0 $@0 0@@PV"$$P 5|ş/?(@@$ 5-@P:,U 8/@P/2 "|" P ,,5D/g  %"@P^ P q @PW"0@PA 0@P; 0@P5 0@P/ 0@P)+2@P%0x"0P RP,DP0 y"@PU<| !|"@P ,"|" !PP)\ "|^"U T P)2(J+B$*CT" 4 (@PQ#w#,^ @DP|"l#@0FB\0"S X \@@"0LS\ 0xp"M#^", @P$"l| P  2PP 0 0  P"" I@\$!#"^00 \0S ? p1/"\"Q00 X^ ? $1/0X02   QP "Px14 ?ߍO/MuqRo(8qrfsPIuwD & (# @t:h: E-,MT@PTpP`  HLX\`d 0 @ ,ЍE/-,M048 <@DH k,Ѝ/-,M0 004 8 <@D R,Ѝ/O-PP,Mp \` 6R 6Ɵ/X 6F/Wx 6pf/ZP `6HƟ/d R(DD6$F/l0S P  6e/T R5ş/Y o@oT  5e/`Q 0PEL  0!@PFX~3[Q TUPX <%谌  ,0 0 0@Ph 4d0$ @P)"  @T@ 8w    00 @,4 @RDP P $@0@@P $o!P  4ß/ 0& ( 0$ 3+@P@ ' @PX ` `I @P 0|X Pd `3B/ N  ,@0S0#4!,0S @DPt")!@ 0 @\ RX \@@ 0 LQ\ ld" ! XX , TK@P# 0l| X  2P    QP L 0l0I@^$!  Q00 \\ p l1/ 0 \ ^00 XP  1/ X  0S0P   Ru S2 ,ЍO/MuqR(8$fPI<D & (# h : T%&xE-$MH@DTpP`  ޵@ LPTX 0@$ЍE/-$M(, 048<$Ѝ/p@-M |1PR`@ hh d1d/T LQ 0@ <1,/    1/  l0080 R      $#, RLP ^018 NR LL  Ѝp@/O8!uqRO- MD`p048< R 0S  2 Ÿ/X 1A/V 1/W 1A/[t 1l/Z _.P 8 H10A/Y PP  1/` 0I@P, 00 0PSQM.x t^<0,N7|Ė\G  xxQG.v ^800, 0"? ЍA/IrfX$t%8|%0@-@P 0MS@ 808/ B SЍ0@/$%80-p@-L0`MP@)P $0( Ѝp@Ѝ/4S /04(Ѝp@%lM(0S /%@-M@ TLL0L D ^ </ Ѝ@/d%$IrfX8%p@-`@MP@e W?&@Pl \\@PdH0 \P唛@P000  Ѝp@/X(j &O-EMMP 0'f QL$ 0S 3ß/ `yU  UU L$R3s/ Lad#|?ApP |@$ @@ $ \k@ l$, @D@ @$@(@E.͍⸕HQ0\0X`V\AtDxDG |D 0SD0D @4DD$KSxDXx1DDDDDDD| 6P; 0Ÿ刄 p)vP.P3e@e0 P!| d@md@jdT ` p1\/@| ,Je,aE0! Qt 4P 5P 5x4SG  k$̓| 0d=X `P 44 $`Lĝ\  X 0@@D P Z @0GTЍۍO/$o&8H]\ H&IrfX^&0@-M P,@U 0R  0/ Q  0/  ( 0@R 0 X 4T@@P\0\ BP 00 0 4 !Ѝ0@/IrfX$f%8jB&k &E-M0P/22222B,@P] @PX@PS-,4)@PH2&(0S $B( @  @(B6BSx a x ύ0B@Pb<0$rpB|BxBtBbr@PM|A|< B@PCxx$ x408xx|"@T  x2||B|"x v@P#txt@P'!@Pp, p3pt"(0@S $ pt(tb @tpr(pDtP x2S2 |"Q00P 88 434ß/|2x  |"Q00x P  2Ÿ/|2x |||"RTv SM x!@Pgp0 60$4tt\KPbF p@ ba@PN !@Pg !@Pa !@P[ !@PU !@PO#@PKD9ͅ @P lP: 1A/lO,\ 0&`dPß@P 00 0"RT2S)Qq*P` \ x   wDT qߍE/&$'8$'DD'lb @-M@,`T d1R \\ X1X/H Q (8 41$/( 0@R0 i4V _PP* pᒨP (0d l P\志P? c0p "`\/=td`P < Ѝ@/IrfX$%8O7-\'p'0@- MP@U0  ^ / 0Q(B/ 0N 0,@| T0 @P$ $  4 Ѝ0@/%$IrfX8B'n 'p@-|4GS@m  x PP$R 25PPx|$p PP Ĕ\ <PP p@/0@-M@PP|4S Q 7PPG  x _sЍ0@/G-QM  P`p0 bj@P  0/ @P  $0dS4ښ@ЍG/p@-M$P`Pd p@/O-DMPU<4 :R  :ʟ/ Q  :ʟ/Z$( 0@R$0dp@TrX*0n@Pi< D)@Pc<@P^< @PY<ĕDT< h00h0< %@P <@P\0SV RR HɟTT @PPT4P0`)<(@ T  < 9ɟ/ )\1SWQ- 1 @PDN8ĕ\ M>xDtQ =tD|$RG  xD6S ĕ\ 0S 0(S H \h@P {P0'l< ^<8 8@e8@$Q Kp G뤔8p $ĕ \ /r y Hs s u xu u v v ly 2S,'?DdQbP 0$"R &%F)^4c\bP&4FkP0\004}FT+"R(DT#,&^ &xĕ@\D 5ş/04Z\PH N 05p%x@QDG%G>@ 0l, @PM x@P$ Q , (5ğ/@ 0@+@P0BT DI 0:P 4 40ğ/ 0@P0t2S$PS4P $hA@PS)P 0@P 2S%Q R`0`` ;h@P0@ 0@P @dTD@P @PM΅x^@Px B@P x\ 2XB/P Z< P@ Pb<4P $R=d <@PO<P ĕdPDDTA $ R> $`dp@`p0@4D00&4Spv@P#> Sĕ\N.64S /0(0)0(!@P$00$0  AA<P <v&T  004ABT` 0@ VsDЍO/IrfX$%8''A'((N@()X((x(%((Y)4)P)Bn -)@-@MpP`]0S S 0 \)\| $d/P  $0pЍ@/$[8@-@P M `0`(\/ hP0 \'"SS Ѝ@/))8@-$@$0 S@/LC)HC@-@^ 0S Q1"\ @/Q? Q$ QQ' Q  QC Q@ QQ< Q: /0S8;1 P R0 Q. 0Q(. $R& + R 41 P R 5Q )0S.' R S Q  R  // 0S Q P 1S0 Q P G-QVMpP 2Ÿ/@  tPakSN `,  0qPPLI@PD V.P"\>P"0P0" P4 P/ P*P' P#P P P P| Pld \TD9@& P-(!X 0 Q,T `U~A+pX[  0~PP  wX%0T`  ZVލG/))8P**0*8*h*L*T**t**D*\****+3)A-PP`Mp 0S P,@0N5@ V,p` ЍA/)O-TMx`Y p 3ß/ ` 4Ph @P4@T80|P @P40S8vQL H0PLPH@T4P vP@ P4^ j@P4\|8dGPw  \@Pu4 Rn8`Vi4 NP@ Pd40S` 4 @P@D PW40S SO8Q ^@ P0 #Q PS> #P;0 8!T1 8P6 P, W @P0@@@@4 P@ P 4 R` Vڰ`   P `  @@x@``  `L ,0U4TЍO/))8**8*+w///////--4 M0$ P 'Ѝ Ѝ/ #  @P 궤<$)$ ἶ$p&80`p4xtdtt|d-.I M; 38pDX"^Q0L HŸHI΍͍p @$x0Q`x$tdL P0xdXPU  #<`0pPpG @ T $\ P+ Bn `F@PE ;Z$ 0 @@@Z0 @ 1@/@P \ 0 0q$TT TU #P^I. _UB@QI΍ UЍۍO/FFID,48DSND48P.a\ 3ꔜ  ) P0A`0S SS U U|`|P@pTXpp0`XOߍO/P0`08x000@-pMd`P0@ `P:00>Ѝ@/0G-PPM P 0 㭿NBAAPP B P`n1#Q ` 01Sr@ @r v Tp` Qr v Tp`v W`@Pv UUU:00!U :UVW WD R P0d LrP! ᝿@ 0!t@PUv PU2PPPPa ^]  ᩿ RaPЍG/WP 00/8, P  //// /0000A-0M`pPRt | d d@@X@T@P@P H0e Y 04芿!듾90000\C0p@- `MV@OhQḾPJ e R 1 J@P> @Q;  0@R@S5P5 1@SP,-``@^00`@2N!"1Ì 0 U 0SUe  P`@^ `Ѝp@/1p@-`M@ Ḿ0PP 徾Ѝp@/E- MQ@ `Np2 0#P20P,2P1 ,P(0(0 (Q  0@/((( R,0,0 $1S  0/,$@T,( ^^H J?@@D  0 0,Ѝp@/!xeL<<8#d==*p@-PPM@` ``0` X ^ P/0< 80 `Ѝp@/<<!xeL8=p@-PPM@` ``0 T ^ L/08 0 `Ѝp@/<<!xeL8=p@-M`PP x0x  h@^ `/T @P  0P@P ԧЍp@/<<!xeL8x1p@-`PM 0/@T 0R  0P/ P l$QU Q  80y PPK/0pPЍp@/<=8!xeL<=A-RMp` 0S a 0/Vb 0P/K d0PP#  g0P iK/d04@p`@@ @$,h,$A(APЍA/<=8>!xeL@-$@$0 S4@/`C$>\C@-@P`` \0 T ^ L/ 0,Sj ,0$/ @/<LxtcL8`>0@-PPM@ 0R  0/T P 0/ R@ 0 s Q@   \Ѝ0@/xtcL<:L8;>0@-PPM@ 0R  0/T P 0/ R@ 0 s Q@  \Ѝ0@/xtcL<}L8~>0/dC@-@P88 40 , ^ $/@/<LxtcL80@-PP@M< 808 0 ^ (/@Ѝ0@/<>gfcL8@-@P>4 00 ( ^ /@/<x?xtcL8@-@P88 40 , ^ $/ @/<>gfcL8P R 0Q/$0S/ Q//0@-PPM 0R  0/Pt  0@  R\ (@T0CQ,, Ѝ0@/xtcL< L8 0@-PPM@ 0R  0/P T 0@@ 0S   \ (@T0CQ,, Ѝ0@/xtcL<L8-MݥЍ/0@-@PMP 0R  0/U P Q | 0 0X ?0p03 Q , 80 0 0Ѝ0@/gfcL<>8E-P M R 3R  2Ÿ/P0S P 2B/p?(X$0$0  ^ t 2pŸ/$0 0$ R(0(0 P ,@ @2(/(\($!?JP!1B00A, 1@@T7 R00P `" 1\/0 R 0 0P " 01/ 0 00A 0@ @0T Xa1:R !t0} @Q$@ L 0 @x @@@@( 0e@ ЍE/gfcL<?8@ @@A8A!'+1A-pPM R 1R  1/P 0S0  P006 4@@!G1^ 0 0 $a0S  1/  Q00 `P  0/00 0古@ h0@x @Tt$@@@ @@@@@L 0@ЍA/xtcL<`A8p( A$ B, 0@-@PMP 0R  0/Uht p0d/@0s@ P @ R@Ѝ0@/xtcL<L8|\0@-@PMP 0R  0/Uht p0d/@0s@ ޤP @ R@Ѝ0@/xtcL<fL8g|\O-pP M0 2R  2Ÿ/Z 2|B/@HTT `2PR/XY  R002b/{ 2/40Q  1Q/ ,`1!PP[  p!1PϠ, H1J 4 ($T(p|@@* (1 0  0 @g̠ 000, \0"@ T$P@ P$@ h( PPX0P ЍO/gfcL<>8|\@BtBBBBhCG-Q M@ 0S  1/T R  1Q/(x!1PS @@P@\Qp@p  @$0 0 P@PP,0` P Pp`PP@0 PP@p`PP 0 |PPPP00 0S P ЍG/<OB8xtcLLRgfcLC9BhC,C؏O-M4MP ($ 0VF >R  =͟/(Q ( =͟/$ R =͟/ 0S =͟/T\ Y x=X͟/YI (0 P: H D=͟/$ R:  =̟/ P* U0@ :&0Y~0@&,@T@Pp , D$@(0 0|03HH0|03 ! D0H<H\  HRHH 0S $ S HH `H   P 0S0 S S &,PU @ @D}P8 ||+h&̍@ | % &T0S! Pu <+ 4;4+} 0  \+;V 0ʟ*0M$PU$0 6) &R D} @ p @DVz}P ll* ^{PT:@I 8- 0 CzP3PU 0 0 zP  :ɟ/  Q00 y0S D  9@ɟ/   T 8@ P0CQ+ D@T9($9PP @W}P`(8ȟQP 8P P 04 D 0R0,0!0 P8 <@ PT P ^ 0s-8 tP ʡQ :œ\@x @@@T4^  K4L PW/00GPP .ʍX5S-0P0SM.[, lƑ0s3P^PM @K-KP K0@sA p pSp9@ߠ P0 XP&P0 %0@ ᫟pGA 0PPEW% 0@p忠 P$ 0@巠 P0% 0@兟@A͍00CpTPN 0pDxx$ R 0`$唠 P@0 WP&P0 %  0^ WP&P % 0R @|%0 J p L wPpUp:UU   @c% 0x1 9 0W  4,P^D3&,  83UD8@$S  ST(<CCX$@Q}rp$  @p۟s R]P  02/О=8 PI  Q0 0B@ pW z 0࣓24P,@U1&,1  TD8Q QX(D$ ( 3AB8IV_D,D-D1$EPTELE|EEEE F$4F3,m8m0>GH>-M $( ,0Ѝ/-M $( ,0 Ѝ/-M $ Ѝ/-M $ Ѝ/-$M(8,0 4$Ѝ/-$M(8,0 4$Ѝ/@- M(,@ @@ Ѝ@/@- M(,@ @@ Ѝ@/@-PP M 0R  0/` R0/ Q A 0pP  ̝@T A !X (0z p 00 Ѝ@/gfcL<V>8ZTFalE-@PMp` `1R XX T1T/P Z:(4 01$/W ^: 1/V 0Ā/zP" 0P p`0 R  0  0S \P$ЍE/gfcL<%>8)pF*F+F4E-pPMP P1R HH D1D/X  $1A/U`  Q:2 0/Z  0R: 0@/@P (@TU  0ЍEBAP  U 0P:ЍE/gfcL<>8|\F!Fp@-@PMP 0R  0/U Q  0`/^ m 0/`P 0S0Pll z  PAP$qD o#Ѝp@/xtcL<L8gfcL>(G@-p M@P`Pp 1/V 0S  T\1T/U P $4 01 / 1P- @@@ 00  @  J O@P 5@PU 00@0S P Ѝ@/<tZ88Z8 ?2>TPG% ㈙X 'p@/A-`p@T05@0205?0@PcU@e@ e@ lpePb@P@pG?W@  SA/L0P $ 0 QP L0,  0 2,$ "2‚, "/0@-P0@SPM 0551/1P$ eUP,02xS |0p/,$ 2C “8\ @00/, A"Ѝ0@/GG8GH0-(((0 @P 0 0/CCC@-@P88 40 , ^ $/4@/G0HCmeM8@-@P88 40 , ^ $/D@/ G0HCmeM80@-PP@M 0 | ^ t/ \HXX0L/T(@ <0(/@Ѝ0@/GHpMEM8,IHI@-@P 0R  0/ R,@ PHTT  ,@R 0LS0,, @/pMEMGH8\II0@-PQM@ 0/T 0R  0|/ R PD\\  ,PR 0LS044 Ѝ0@/GI8pMEMH\II@-@P 0R  0/ R @ PHTT z @R 0LS0,, n@/pMEMGwH8z\II@-@P 0R  0/ R@ PHTT G @R 0LS0,, ;@/pMEMGfH8i\InI0@-PQM@ 0/T 0R  0|/ R PD\\   PR 0LS044 Ѝ0@/GUI8pMEMWHZ\I_I@-@P 0R  0/ R$@ PHTT  $@R 0LS0,, @/pMEMGFH8I\INI@-@P 0R  0/ R(@ PHTT  (@R 0LS0,, @/pMEMG5H88\I=I0@-@PPM 0 ^ /\ P0SXX 0m(P\ 0 0CS00 0aЍ0@/GH&pMEM8)\I.IO-@PMP( H1R @@ <1</[*$ 1a/pQ ,U`0``PdPhPXP\PS` W ZP 0x03R`!`3`dPhX\`0CQ0LL VW /ЍO/CmeMG0H8IIJ0@-@PM 0R  0/PPPQLXX 0PP LR 00 Ѝ0@/CmeMG0H8IJ0@-@PM 0R  0/HPPQLXX 0HP LR 00 Ѝ0@/CmeMG0H8IJ0@-@PPM 0 ^ /00P\XX gHP0 C\00 [Ѝ0@/G0HCmeM8IJ0@-@PPM 0Z ^ |/00P\TT 3(P0 C\,, 'Ѝ0@/G0HCmeM8IJ0@-@PMP 0R  0/0QXdd U U`P @\,, Ѝ0@/CmeMG0H8IJ0@-@PMP 0R  0/U P ; 0/ 0S0Tdd 00 0BS00 @Ѝ0@/CmeMG,J88aDbO-0 MSp< @9.0 )q ^  0!q QU `R  0 0A V@PU@`$XY( 808 p * ЍO/\CJJ 0K0@-@M0PS @Q =@T  @TᕔP` \0\/, 0BS088 Ѝ0@/|CCGKC,K8`L)tLWLA-PPM`p 2R o 2Ÿ/Vhp l2`B/R P,<<"F ^( $2Ÿ/  @ 0Q!-p0 { 0BS0!$(QE:0 Q@p`!  & 0BS0! 4 Q  4 0BS0  P LQ\q0$0 `R LQ XX ЍA/pMEMGH8S\ILLL  IE-@P MP 1R  1/U 1a/`pE pE^ \t p1X/`0  0S044!m  LQ Y  0`PU \ P\:Rd 0R`0PPLQ0\\ 4Uhd/ ЍE/CmeMG^0H8_xCc MkIoJA-@PMP`p  1R  1/U 1/   0CAQ l 1h/ 0ЍA80  ^ ,,!  0Q   0 `PU \ P\:Rd PRPP0CQ0\\ Uhd/ЍA/CmeMGk0H8lxCt M{IJG-pQ0$0WP*X :H R L0S /@P; L0P$,LP‘ ",$0"| @T R`H xR  L0Q@T 2Ÿ/Qk /@P0 R !᭐ /@`x /P0@oL@ L x`00  x`?Q0 @@x 3PC:R Q`x@om,  0@h,0 0 0@h @R  | @@|0,  @0 0| `|@00,Ž, 0," 0N 0PP@ ̏G/Gn0M80@-\ @0@MP  P 0P@Ѝ0@/xC-QMOЍ/G-aPM`0 1@ !1k 0P/ R[ $ Vp1 p!a l  R 0 S3  Q\0@P$ 1/0 C  P:   :p 0R@ t0 |0 C* p @00  @ЍG/xC9\C`M@ @GK8 00E-@P M 2R  2Ÿ/DR PLXX"P 0SP#Y*PU $ \  2Ÿ/0$0  0C?p PUP!p PP 0P Pp$P$,0W:P LR ,,!PU $00 0C $00  R @\ kU 0 R p ^  00 CR X@ I ЍE/pMEMGH8\IMLLIxC@-@P MPp` 1R  1/0 Pt!pPk0P R $80!U, 1UP `0 pX R ``VP\0``0`P TR X0T S R0 @\4UT Vhd/ Ѝ@/CmeMG50H88I<xC9MJA-@PMPp 1R  1/  0ЍA[0 `V`t!`0` R $<4!nV 1VP  0X R `PUP\PPPP TR X0T S R|0  @\4XX 2Uhd/ЍA/CmeMGA0H8xCGIK9M\J@-PPM`p 1R || x1x/VT` \1PA/W P 4 01/D 1?@P5  0`0, $ $ (0 4 @``\ p`V@pl@ t0 `p@t  BQ $PP Ѝ@/CmeMGM8\U,N!pMEM6L9LA-PM 3ß/PU 2R  2B/ P "40c Q  2r/p@W ^Pxx"h0% R PP"\$`VŸ/$` L$ 00  a + 1Qg  0BS0 !.\<|l!#^ 0 0 p0S P L1/ p P00 lQ  1/l t 0@t0N\h 0 0D <0W APtt ЍA/GX\N8pMEMZH]tNbNinLMLNN0@-PQ@M0 /\ h0Sdd 0 4⤋\C 0$0CS(( 0Ѝ0@/|\G8D\IJI@-@P`pM4P0  ^ /h0Sll 0p ᒋ j0(C\0 Dp_Ѝ@/0HGCmeM8IJA-`PPp 0 ^ x@/Uh d0HT/᫋@ 0 @P/A/GMCmeM8O-P4M($ 2R  2Ÿ/( @Q"(`p$P(,@0`h\$ R LWD" 廋(P  $R$ 0S 0孋 $弋(0p$PWl[Z A!1 dg$噋 /1\g ,!1Vg !1Pg !1Jg /p1Dg pd!`1>g `T!P18g PD!@12g<, 0$,p `P]@P,0T0 M[4 $($( 0CQ j4ЍO/CmeMG0H8IOON$O\C8Ozd_LOXOdOpOxOO؉OOJp@-0@`P` \XX5 P $0BS  0%p@/IG46J@-4$PM0S07$@T00 C\  3ß/ R00 C0S  3ß/0d00@Pp  0@R 4PP#lP < 83ß/^\ (`Vp `A R` Ÿ0 S2Ÿ/$V:0a/ R000Q @x t2DŸ/  P000S $ $2/  0@T$pW /00S l 1p/(^ `,B R` P,`0 SP1 /$V ,/ @0 /@ T:| /Q / R008  /lЍ@/CGKCqO8PCs |2|Ÿ/@T `2R HT P2@Ÿ/U 4 02Ÿ/ -  0CN^  1/ 0P R x!K00PC0PL B\G <lB0 ^ @4!0 E 0S0  c 0f0PUx 0p/0 P@0P0CQ ,pp U ЍE ЍE/GQ8CmeM0HxC MI QJp@-`P 0/@T 0R  0P/Q 00Sl 0hP/0 P@0PLQ$HH U| 00p@/GQ8CmeM0HIQJO-M`,Pp(0 0S L D3Dß/W$, (3C/X  3R/BP /PP V2@$0$` b0@4j``D`H`L`P`T`X`\```d`h`$0(@p ,```l`p`t`|``````` /P,V $" = [:x0$0x /P|> $ !+! $ /P- @!0$@P80S0!A 1QP@P@P LR   , P,Q /|Q /Q /P00(5`  /ЍO/GQ8QR|CLCmeMxCC>KC0? 050?S@@@bP rP?@@@T@P:?@D  drA/`a8a0@-PQ M@ 0/TI 0/Q   00. Q ~  ^x   U !1 !3Q\ q Ѝ0@/`#a8a(a)aO-pTM  0`$0@(P(@,P8@浠 8bf+2T ,@PH$0( Ġ@(+@"Č8P, 6g1# )gK# @[8$  0(  p `0$($LDp<`@`p(H40`p0P,p 0P`@0,@ Q`(!1 "Š4is,<0a'H @p @@ D0 @e @" 0&   #@Hp DPk1$ @.,@0p k;# P4L@WpHP040`<D @  0LP D0H <@  Dp Hp@P0@p<`  @P00  @PTЍO/@eO-cM pt!          x| hl `d PT HL @D PP(Q0P,41p쀍p ఝ 0  ( !1Pp0@0AQ8` a$q !7!i Y ,w ,)ၛ4`{Pа嬴0찝pAt10`P`0#P+. x$%aP#ई輠@(~` ` *4  , $` 찝 Ϡ|+Q3$D$ ḀpBP0B_`> F?@P`P%p&쀝 ᨳᨰp!"  0W  0p',lg  @`, $P`谐 `&#8 P%$H(  p0 # $ਰ %4A &P( 0`L0@PhlXA\Q4^F n $BO0  Z 0V/ 耍쐍! 1AQaq$P` HQLaB`耡儱FPaTq~8<@qDx|@0,A,(, 0 \Xa)@1Xq地YX) !ƅln++ɠX唀d` Yჱ X誄iP吐^ᢠ"\vጀ`P,Qˠၿdhp儰|吠 蘀 ( )``Ep#àhP` `&l=!P%$C% Ϡt)&X\0肏ကha)RTP*^_`0 (Ath(ap QqlAxLPXpphXp\lq+h1l Ϡ CVoHD@VN? M0@ha Pl@Px0 SPR_`pp'(>0#@$P`P%@ `&0#p'(Z  䠝XX\P0H 0# @$0 @R?  @X p P` 0.@ !$ " @ `d,=0P[0x1|AN_`V?耑儡RZ HqLhl!PTX\81 p N0p(P`VPN?`0 - @8 $8<80000 @ p$(P,` 04cߍO/bO-M @ H0  A1 p P  ` ' <)D!d̊" 0 @tlldP`!壱  0 pP`P`!( ,8 (hX.Hx0@ @0D@HL   pQPQp a Q @Q a m 0P@~ m p Pm @P PHpt 0@ x |0 ЍOG-Qp 0/Y* dPp@ 0P#d< dP D|0`tl@l 0@ #88$H(0@0^G/,a4a80@-@P4MP 0/UP  l0 0#"  0P `P 0 Sm4Ѝ0@/,a4a88bG-Qp 0/Y* Pp@ 0P#d< dP D|0`tl@l 0@ #88$H(0@@^G/,aETa80@-@PDMP 0/UP  l0 0#"  @P P @ lDЍ0@/,adTa88bG-Qp 1/YY 1|| P`p!@.p<T$ĠHApD@!0Q#8^ 8,H(0@?a 0$@  @8\()8 l ?\) @ ll(@ 8 l(8 l( 0(`0d@  l8$0 $#  QG/,ata80@-@P$MP 0/UP  vl0 0#"  P @P  4l$Ѝ0@/,a ta88b@-@PT  Pl 0@ D0H L0@/@bA-RPpo PQ  1/@ D>0A> `cXP01@: Ml@1@ T@D SH0 0@H0L@Ppf2l@;@ R Hp@D  Q*H00@H0L@P@X X  l@1 0S@D RH0 0@H0L@A/,aa8@-M`P pb   @ Ѝ@/@-@PT  Prk 0@ D0H L0@/e@-M`P p  L  @VЍ@/E-RMPG PQ  1/ $>?0A$ @`cZ(p01&: k 00@ 0$@ fZ kU 0̠ 0`@ 0$@@J@(`?Z@ Z mk 00@ 0$@ЍE/,aa8@-@P< @ (j 0 $0@/@f@-lM`P p   @lЍ@/0@-$MP   /k  @j$Ѝ0@/0@-@P$MPm 0/UP l00#"  P 8P j$Ѝ0@/,ab88b@-@P< @ (j 0 $0@/`f@-lM`P p  w  @lЍ@//p@-`@| Pjj    &0x p0t p@/p@-P`| @Sj00 Ġ% 0x p0t p@/@-| @?j40  0x p0t @/9@-| @*j 0x p0 t@/-QM \D @0ЍЍ /Ѝ//f80@-@MPIjkP| 0i0np0ej0Ѝ0@/@-0xM@ S0P0xЍ@/@-0xM@ S0?0xЍ@/@-0xM@S0.0xЍ@/@-0xM@ SS00x0xЍ@/@-@P PL L0  "8#,E0 V@/f\Cf@-@4\ 4 \@ @0 $ 40(E0 3@/f\Cfp@-P`| @Xi 0  Ġ%0x p0t p@/p@-P`| @@i 4R& R 0p  p &40(/0x0t0p@/f8p@-PM@P`P 1/0S S 4"4^\0s  D"40 tl l0KE 0D唰pP V@ @$Ѝp@/ff8\CfA-PPMp8y 010/0S S@= 4"4 傀ihP` 0@/@@P0 b\@x ~ zxᡫ|Q0 <0(/x@ЍA/ff8,9fff@-,M@`pPتP@0 < 8D0 8i 00B,Ѝ@/TT\C@-Mt`Pp   @Ѝ@/PQp@-00@P` 50/p p0R3Q/Q Q%  gP  gP 0 S  S R Rgp3p@/fS8  @-@T \ 0^ \ 000 @/R  R 0S0  R R \a@/@-@^:0S @dR0g ^0 N R` @/p@-@Q`0 P/gP:h0\ T/ gP $0%%!/!p@/\Uf8fp@-@Q`t0r P dd/ gP:$v 0/p@/\Uf8f0@-@PPM 0|/U` `0X/4 0@P rg 00Ѝ0@/ftZ8Xo -@-@Q M0 p$P` |/ 0Pf 0Pf;gP:, (0 / Ѝ@Ѝ/\Uf8f -@-@Q M0 ` p$P / 0Pf 0PfP: ^f gP8 40:(/ Ѝ@Ѝ/\Uf8fp@-@Q`0{ P/fP:0| / P ^:~f fP0 ,0: / p@/\Uf8fp@-@Q`0d P / P: ^Mf fP0k ,0: / p@/\Uf8fG-R00?MU$RPQP@T f  +TPX @0T xXXX P\0@6` 0C  0 g@ePd P0 S@ T0@4#0O\Q 0 PPЍG/<9@-(0M@P`T 0R(0P <B 414/`  `BV 1/` @0( $pR$p  0S  0/$ $Q(0(0  R l| |0d/(00($ R(@@$(@@TЍ@/gg8 hggg@- @Rttt0t/0AS0 R 0\8 40(/0 0@/g7g8=gp@-`QP<< 818/@T 1 / R0/ 0S 0/ 0SP  0/   CRLx t0H/ R(@0@$0(@p@/go$8q!rhs$hyg}hg0/@/00S/Q/C//0@-@PPM 0 ^ /Ul| x0l/H0S-T 0},0(00LS0 0sЍ0@/gDhKSAT8!hhO-PPM,p 1R  1/ Z* 1A/Pp!A@G 0(` SB: S@[ 0 S;( R \50 R /V$0$0 Q  0/$00$ R(0(0 P  0/(($0P(@ @$ (0@@T0CQ}@ ЍO/KSATgDh8ih(iHih-M00jЍ/-M^Ѝ/0@-@MTP 0R  0/ P  0/0Q\pp 0SPPPLPP @R 44 Ѝ0@/MKSTg!hi8"i& j-PI99(rEnGrM7bRMIT j p@/*RID@t$u8tt@-@pc ;` P0  `0 1`!0 !!  0e!q#"@TPP0@ P0@/@-MP`@p R R R   0@@DTT T T T     \ 1! W  P # 0a 0Ѝ@/ Q 0 a 0R b0bS0c S R 0 R /@- 0MS@`p5 P pPUPpPp U:!0~ !0x 0  00  00P0 Ѝ@/ 0S0 0S SP//- 0\ 0   0S 0.00/p@-@P`Ph0hh  \ ^ T/4\< 80,/ p@uustnE80v0@-@PMP 0R  0/U P x 0t/0QH\\ \  @ @R 44 PЍ0@/etnEu^Dv8_vavfw0@-@PM0S00HHH 0P 30,C\(( P*Ѝ0@/UuvWw@-@Pp`PM 0 ^ /d0Sll 00 0O\P0008C\0 Ѝ@/u*DvetnE8,v3w@-@PpPM`0  ^ /@0S 0͙  P.U P Q# (B\44 崙Ѝ@/uustnE8vw0@-PPM 0R  0/P 0B0 S \ 0S / @TAP,, rЍ0@/etnEuDv8vwE-PPM 2R  2Ÿ/X 2B/Pz"C 2QP j  V  P`V|R@p )R{ $RpvlR@ *!0@p"@T@n 3Q0l 0 Q0n uPPpIRsP @9p@!?C@P0 P! P 8 Q0Z00`0 W000`004bV@4•`0B` (2BP4B(@  @@tQAP Hph 岘  Q`vZЍE/etnEDwDv8vPwstnEwO@-@@ P0Q 8 @/lw9p@-RM@3P@ `PP,P` ``s+ PP@@@ Q.CQPЍp@/|wu9xw0@-RM`P*0@ 0S <DQ@ Q,,Q@ 0Ѝ0@/`9w9wp@- P0M`Pd 0 w@T 80@ @ Ѝp@/u@-PP Mp 1R  1/W P P\ X1LA/`Q 0!! 17@P& `P, P `O4"R@420B0(4B(…@ 0BS0 d`0CQ @dd 岗>.  0卾 Ѝ@/etnEuDv8 xvstnEwG-PPMp, 1R  1/W 1A/X P t 1pa/QD``!e,!P1@P/ 080!`P 2(0 0p ` P `lO4•0\@4"0B 0(4B(@ LR h` LR @ll $d 0ЍG/etnEuaDv8b@xc xevgstnEwA-pPM`@P (1R   1/V P  0耟/EQ 0/T@U*@ kPUPP00SU @hh h0`&P U<TЍA/etnEuTx8xy<%Q  A@T:X^ HP%@P\" rGP P00| GpP lHP@ H@ HG@@ЍA/|\t8P}d9x}A-pPMP< 414/U 1 /  0SR@B /H>$Ȁ  @@T:XQ KHP@|`\ GP P00 Hp bGЍA/|`K8\td9A-pPP`  1/U 0@/V 0//FPP/F@P G@gP F0@@G G R0GA/||}8\t-0 }0@-PQ@PM  0z/?! P)0  }!# 00 0GP0G0Ѝ0@/}|80@-PP@\M h0hgd/T P0Dh@/ "PP @ \Ѝ0@/`K|8}Pp@-P`@x' p0p/VP( P0H/0000500:0p@/}}8~Pp@-P`@x6 p0p/VP7 P0H/0000500:0p@/}}8~p@-`XM@ EP;0)0 ; x051 P-,1!@\! !K P!!FP@P KPFPDD@@P JPEPT \W T0T/EPF3!P XЍp@/~ ~8@P/0@-@P MPg 0/Uth t0l/ EP0  0S P 0@0 Ѝ0@/,~8~8DW0@-@PPM`0` TX/U @0S(F 6FEЍ0@/8~,~8A-pP@MP0 +/ D`P0,`yEP@" ^ 000 K00 0 EP0@E0@ЍA/8~,~8P~0@-M @DEpP*F]P aP P@8@ 0e 0a!P0 @婌"@& T! DP@ 0P h@hd h0Ʀ\DD 0忦@@UEЍ0@/\Cd~\~dC8$8t~~~@-H@0S 4 ( @/C999-M 09S00Ѝ/9-M 09S00Ѝ/9-M 0S900Ѝ/9-M 0S900Ѝ/9-M 0Ѝ/9-M 0Ѝ/9-M 0Ѝ/9p@-M0S6`P0`.  }Dp@cE @ e 0 0 @t" 0#P)0 P1EDPP00D`D0Ѝp@/C9\Cd~\~A-M0S[PPx1PS  4Dp@E @ DP;D ЍA/C9\C\~d~@-D0@S00 ,0,//@/8-PM<< 80 0 ^ (/Ѝ/e doiOI8@-@P88 40 , ^ $/ @/doiOI8p@-H0`@PT @ C C p@/C!$/4/@-@l0Sdd 0 0(0C,àS08<< @  ( ! @@/ 0@-@PMP 0R  0/U 0/P`tt ˊ(1(P | FCP LR 88 Ѝ0@/oiOId88 0@-@PMP 0R  0/U P x 0t/0QH\\  AR 88 z@Ѝ0@/oiOId8P @-@P`pM$P0  ^ /h0Sll 0P rB JB0(C\44 4p?Ѝ@/ᄀoiOI80rA-`p@8 Q6 Q: 0/ĀQ0LS0"!0\B \v10 0# v0 0# A/V\8p@-M @B[ Bp` )C  0 `跉"Ѝp@/Pw0@-@Q MP 0S 1/ P $q* (^$ <Q  0/ $0<0 $P(0(0 8^ p| |0l/0(8 $ ( \6 Ѝ0@/x8ȁ0@- M0@0 P$q* (P$ DQ  0/ $D $P(0(0 @0S pp t0l/(@0 $ ( \8 Ѝ0@/8O-M MxP`(@΍@DP 0(' dȍ AV ? 0 ȝPȝt  @ȝPȝ< 0 @lЍۍO/dC4DO-4 P< A9 ,b$PW p0S0p !up8Q  <0$S(8 gmOI!O-MpP04 7R 7ǟ/[ Q  6̦//P4B P H^$4    4B*  D @6$,Ɵ/4Bp]+0Sj*Uh PPU  +`N+4"P@*P4U`4 P*5ş倥%0 ݋XP)S'+]P P P `PaPiP 301iO $4e S0$@q"P O4"e*!D`V PE_) 5*@$.\ ,*TP^ 04`$ X DQ 4 #>*P*i_ h34e 3@0bL#PEqXr4R #>*P*\P i_ E#43e @0#P"q Y40Q"q~*i_ %24e 2@0@"Pq4"P,RO 0G*P$( Q!4(P0 <*pN*io 14Re 1@(R0|!P`p42 $ )4@4@4@@4 R $j!p40\4p 1@4B@ @4@4"D@420 ^ @R !p W4 0 y \P4R@@)1 #>)Pwa ߍO/gmOI8PЍ$\CdC8$8 C9A<S`^ j!> DiG 9.5.0-P1 <<>>; (%d server%s found) short_formprintcmd;; global options: %s %s Usage: dig [@global-server] [domain] [q-type] [q-class] {q-opt} {global-d-opt} host [@local-server] {local-d-opt} [ host [@local-server] {local-d-opt} [...]] Use "dig -h" (or "dig -h | more") for complete list of options can't find IPv4 networkingcan't find IPv6 networkingWhere: domain is in the Domain Name System q-class is one of (in,hs,ch,...) [default: in] q-type is one of (a,any,mx,ns,soa,hinfo,axfr,txt,...) [default:a] (Use ixfr=version for type ixfr) q-opt is one of: -x dot-notation (shortcut for reverse lookups) -i (use IP6.INT for IPv6 reverse lookups) -f filename (batch mode) -b address[#port] (bind to source address/port) -p port (specify port number) -q name (specify query name) -t type (specify query type) -c class (specify query class) -k keyfile (specify tsig key file) -y [hmac:]name:key (specify named base64 tsig key) -4 (use IPv4 query transport only) -6 (use IPv6 query transport only) d-opt is of the form +keyword[=value], where keyword is: +[no]vc (TCP mode) +[no]tcp (TCP mode, alternate syntax) +time=### (Set query timeout) [5] +tries=### (Set number of UDP attempts) [3] +retry=### (Set number of UDP retries) [2] +domain=### (Set default domainname) +bufsize=### (Set EDNS0 Max UDP packet size) +ndots=### (Set NDOTS value) +edns=### (Set EDNS version) +[no]search (Set whether to use searchlist) +[no]showsearch (Search with intermediate results) +[no]defname (Ditto) +[no]recurse (Recursive mode) +[no]ignore (Don't revert to TCP for TC responses.) +[no]fail (Don't try next server on SERVFAIL) +[no]besteffort (Try to parse even illegal messages) +[no]aaonly (Set AA flag in query (+[no]aaflag)) +[no]adflag (Set AD flag in query) +[no]cdflag (Set CD flag in query) +[no]cl (Control display of class in records) +[no]cmd (Control display of command line) +[no]comments (Control display of comment lines) +[no]question (Control display of question) +[no]answer (Control display of answer) +[no]authority (Control display of authority) +[no]additional (Control display of additional) +[no]stats (Control display of statistics) +[no]short (Disable everything except short form of answer) +[no]ttlid (Control display of ttls in records) +[no]all (Set or clear all display flags) +[no]qr (Print question before sending) +[no]nssearch (Search all authoritative nameservers) +[no]identify (ID responders in short answers) +[no]trace (Trace delegation down from root) +[no]dnssec (Request DNSSEC records) +[no]nsid (Request Name Server ID) +[no]multiline (Print records in an expanded format) global d-opts and servers (before host name) affect all queries. local d-opts and servers (after host name) affect only that lookup. -h (print help and exit) -v (print version and exit) DiG 9.5.0-P1 port numberinvalid address %s;; Warning, extra class option ;; Warning, ignoring invalid class %s looking up %sixfr=;; Warning, extra type option serial numberhmac-md5hmac-md5-digest-bits [0..128]hmac-sha1hmac-sha1-digest-bits [0..160]hmac-sha224hmac-sha224-digest-bits [0..224]hmac-sha256hmac-sha256-digest-bits [0..256]hmac-sha384hmac-sha384-digest-bits [0..384]hmac-sha512hmac-sha512-digest-bits [0..512];; Warning, ignoring invalid TSIG algorithm %s Invalid IP address %s Invalid option: -%s ;; Warning, ignoring invalid type %s parse_args()making new lookupdig.cbatchfp == ((void *)0)HOME%s/.digrcconfig line %s .digrc argv %d: %smain parsing %s%@couldn't get address for '%s': %s;; Invalid option %s noaaonlyaaflagadditionaladflagallbesteffortbufsizebuffer sizecdflagclcmdcommentsdefnamednssecednsfailidentifyignoremultilinendotsnsidnssearchqrquestionrecurseretryretriesshortshowsearchstatstcptimeouttracetriesttlidvcInvalid option: +%s ;; Warning, ixfr requires a serial number couldn't open specified batch filebatch line %sbatch argv %d: %smain()isc_app_startisc_app_onrundns_master_stylecreatenoheadersheadersnocommentslong_formprintmessage(%s %s %s)isc_buffer_allocate; %s ;; Sending:;; Got answer:;; ->>HEADER<<- opcode: %s, status: %s, id: %u ;; flags: qr aa tc rd ra ad cd; QUERY: %u, ANSWER: %u, AUTHORITY: %u, ADDITIONAL: %u ;; WARNING: recursion requested but not available;; WARNING: Messages has %u extra byte%s at end dns_message_pseudosectiontotextdns_message_sectiontotextdns_rdata_totextisc_time_now((&now)) == 0 from server in %d ms.say_messageshort_answer;; Query time: %ld msec ;; SERVER: %s(%s) ;; WHEN: %s;; XFR size: %u records (messages %u, bytes %llu) ;; MSG SIZE rcvd: %u ;; WARNING -- Some TSIG could not be validated;; WARNING -- TSIG key was not used.;; Received %llu bytes from %s(%s) in %d ms 46dhimnv46bcdfhikmnptvyxQUERYIQUERYSTATUSRESERVED3NOTIFYUPDATERESERVED6RESERVED7RESERVED8RESERVED9RESERVED10RESERVED11RESERVED12RESERVED13RESERVED14RESERVED15NOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDYXDOMAINYXRRSETNXRRSETNOTAUTHNOTZONEBADVERS09<9P9X9`9h9t9|999999999999: ::$:,:4:@:H:P:X:99999`:dighost.c(search_list).tail == (search)(search_list).head == (search)freeing server %p belonging to %p(lookup->my_server_list).tail == ((dig_server_t *)ptr)(lookup->my_server_list).head == ((dig_server_t *)ptr)freeing buffer %plookup != ((void *)0)try_clear_lookup(%p)query to %s still pendingquery != ((void *)0)clear_query(%p)(lookup->q).tail == (query)(lookup->q).head == (query)(query->recvlist).tail == (&query->recvbuf)(query->recvlist).head == (&query->recvbuf)(query->lengthlist).tail == (&query->lengthbuf)(query->lengthlist).head == (&query->lengthbuf)query->recvspace != ((void *)0)sockcount=%dcheck_if_done()emptyfulllist %ssockcount == 0recvcount == 0shutting downcancel_lookup()flush_server_list()(server_list).tail == (ps)(server_list).head == (ps)%s: count == 1memory allocation failure in %s:%dmake_empty_lookup()!free_nowservname != ((void *)0)make_server(%s)clone_server_list()clone_lookup()looknew != ((void *)0)requeue_lookup()too many lookupsbefore insertion, init@%p -> %p, new@%p -> %pafter insertion, init -> %p, new = %p, new -> %pmemory allocation failuredestroy_libs()freeing taskfreeing taskmgrlock_lookup %s:%disc_mutex_locksuccesssendcount == 0((lookup_list).head) == ((void *)0)current_lookup == ((void *)0)freeing commctxfreeing socketmgrfreeing timermgrfreeing key %pdestroy DST libdetach from entropyunlock_lookup %s:%disc_mutex_unlock(*((&lookup_lock)) == 0 ? (*((&lookup_lock)) = -1, 0) : 34) == 0cancel_all()cancelling query %p, belonging to %p(lookup_list).tail == (l)(lookup_list).head == (l)bringup_timer()have local timeout of %disc_timer_createsend_udp(%p)working on lookup %p, query %pisc_socket_createisc_socket_bindrecving with lookup=%p, query=%p, sock=%pisc_socket_recvvrecvcount=%dsending a requestisc_time_now((&query->time_sent)) == 0query->sock != ((void *)0)isc_socket_sendtovevent->ev_type == (((2) << 16) + 2)send_done()sendcount=%dsendcount >= 0(sevent->bufferlist).tail == (b)(sevent->bufferlist).head == (b)sending next, since searchingfollowing up %sfound NS set;; BAD (HORIZONTAL) REFERRAL;; BAD REFERRALdns_rdata_tostructfound NS %d %sadding server %s(lookup->my_server_list).tail == (srv)(lookup->my_server_list).head == (srv)setup_lookup(%p)dns_message_createresetting lookup counter.cloning server listdns_message_gettempnametrying origin %s'%s' is not in legal name syntax (%s)using root origin'%s' is not a legal name (%s)dns_name_isabsolute(lookup->name)recursive queryAA queryAD queryCD queryadd_question()dns_message_gettemprdataset()insert_soa()dns_message_gettemprdataisc_rdata_fromstructdns_message_gettemprdatalistdns_message_gettemprdatasetinitializing keysdns_message_settsigkeydns_compress_initstarting to render the messagedns_message_renderbeginadd_opt()setting udp size of %ddns_message_setoptdns_message_rendersectiondns_message_renderenddone renderingcreate query %p linked to lookup %pstart_lookup()(lookup_list).tail == (current_lookup)(lookup_list).head == (current_lookup)check_next_lookup(%p)still have a workerlaunch_next_query()ignoring launch_next_query because !pendingsockcount >= 0sending a request in launch_next_queryisc_socket_sendvevent->ev_type == (((2) << 16) + 1)tcp_length_done()recvcount >= 0b == &query->lengthbuf;; communications error to %s: %s (((query->recvlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)recving with lookup=%p, query=%presubmitted recv request with length %d, recvcount=%dsend_tcp_connect(%p);; Skipping server %s, incompatible address family ;; No acceptable nameserversquery->sock == ((void *)0)isc_socket_connectdo_lookup()recv_done()lookup=%p, query=%pb == &query->recvbuf(sevent->bufferlist).tail == (&query->recvbuf)(sevent->bufferlist).head == (&query->recvbuf)no longer pending. Got %sin recv cancel handler;; communications error: %s ;; reply from unexpected source: %s, expected %s ERRORWARNING;; %s: ID mismatch: expected ID %u, got %u ;; ERROR: short (< header size) message;; Warning: ID mismatch: expected ID %u, got %u ;; Warning: short (< header size) message received;; Warning: query response not setgetting initial querysigdns_message_getquerytsigdns_message_setquerytsigbefore parse starts;; Warning: Message parser reports malformed message packet.;; Got bad packet: %s %d bytes %02x ;; Truncated, retrying in TCP mode.sending query %p SERVFAIL replyrecursion not available;; Got %s from %s, trying next server ;; Couldn't verify signature: %s freeing querysig buffer %pafter parseisc_timer_resetnext_origin()in TRACE codein NSSEARCH codestill pending.check_for_more_data(); Transfer failed.; Transfer failed. Didn't start with SOA answer.got the second rr as nonsoagot an SOAthis is the first %ddoing axfr, got second SOAdoing ixfr, got empty zonethis is the second %ddone, since axfrgot a match for ixfrdone with ixfrmeaningless soa %devent->ev_type == (((2) << 16) + 4)connect_done()query->waiting_connectin cancel handlerunsuccessful connection: %s;; Connection to %s(%s) for %s failed: %s. event->ev_type == (((1) << 16) + 2)connect_timeout()trying next server...resending UDP request to first servermaking new TCP request, %d tries left;; connection timed out; no servers could be reachedsetup_libs()can't find either v4 or v6 networkingisc_mem_createisc_taskmgr_createisc_task_createisc_timermgr_createisc_socketmgr_createisc_entropy_createdst_lib_initisc_mempool_createCOMMPOOLisc_mutex_initsetup_system()lwres_context_create failed/etc/resolv.confparse of %s failedcreate_search_list()ndots is %d.127.0.0.1add_nameserver failed::1copy_server_list()setup_file_key()Couldn't read key from %s: %s ;; Couldn't create key %s: bad algorithm ;; Couldn't create key %s: %s setup_text_key()dns_name_init.in-addr.arpa.len != 0Ucontext.cmem != ((void *)0)contextp != ((void *)0) && *contextp != ((void *)0)contextp != ((void *)0) && *contextp == ((void *)0)malloc_function == ((void *)0)free_function == ((void *)0)lwres_context_allocmemlwres_context_freememlwres_context_initseriallwres_context_nextseriallwres_context_destroylwres_context_createlwconfig.cbuffer != ((void *)0)size > 0Ustr != ((void *)0)strlen(str) > 0Ufilename != ((void *)0)strlen(filename) > 0Unameserverlwserversortlistoptionsno_tld_queryndots:confdata->nsnext <= 3nameserver %s lwserver %s domain %s confdata->searchnxt <= 8confdata->sortlistnxt <= 10options debug options ndots:%d options no_tld_query lwres_conf_getlwres_conf_printlwres_conf_parsegetwordlwres_strduplwres_conf_clearlwres_resetaddrlwres_conf_initcp != ((void *)0)lwinetaton.clwres_net_aton01234567890123456789ABCDEF0123456789abcdef%x%u.%u.%u.%ubyaddr.cbyaddrp != ((void *)0)(((byaddr) != ((void *)0)) && (((const isc__magic_t *)(byaddr))->magic == ((('B') << 24 | ('y') << 16 | ('A') << 8 | ('d')))))byaddr->event == ((void *)0)byaddr->task == ((void *)0)(*((&byaddr->lock)) == 0 ? (*((&byaddr->lock)) = -1, 0) : 34) == 0((*((&byaddr->lock)))++ == 0 ? 0 : 34) == 0(--(*((&byaddr->lock))) == 0 ? 0 : 34) == 0event->ev_type == (((4) << 16) + 30)byaddr->task == taskevent->ev_type == (((4) << 16) + 16)(bevent->names).tail == (name)(bevent->names).head == (name)address != ((void *)0)%u.%u.%u.%u.in-addr.arpa.ip6.int.ip6.arpa.0123456789abcdefcompress.ccctx != ((void *)0)mctx != ((void *)0)(((cctx) != ((void *)0)) && (((const isc__magic_t *)(cctx))->magic == ((('C') << 24 | ('C') << 16 | ('T') << 8 | ('X')))))dctx != ((void *)0)edns >= -1 && edns <= 255(((dctx) != ((void *)0)) && (((const isc__magic_t *)(dctx))->magic == ((('D') << 24 | ('C') << 16 | ('T') << 8 | ('X')))))(((name)->attributes & 0x0001) != 0 ? isc_boolean_true : isc_boolean_false) == isc_boolean_trueoffset != ((void *)0)labels > 0(((name)->attributes & 0x0001) != 0 ? isc_boolean_true : isc_boolean_false)lookup.clookupp != ((void *)0)((((lookup)) != ((void *)0)) && (((const isc__magic_t *)((lookup)))->magic == ((('l') << 24 | ('o') << 16 | ('o') << 8 | ('k')))))lookup->event == ((void *)0)lookup->task == ((void *)0)lookup->view == ((void *)0)(*((&lookup->lock)) == 0 ? (*((&lookup->lock)) = -1, 0) : 34) == 0((*((&lookup->lock)))++ == 0 ? 0 : 34) == 0lookup->view != ((void *)0)(--(*((&lookup->lock))) == 0 ? 0 : 34) == 0!dns_rdataset_isassociated(&lookup->rdataset)!dns_rdataset_isassociated (&lookup->sigrdataset)lookup->event->db != ((void *)0)lookup->fetch == ((void *)0)event->rdataset == &lookup->rdatasetevent->sigrdataset == &lookup->sigrdatasetnamereln == dns_namereln_subdomainevent->ev_type == (((4) << 16) + 1)lookup->task == taskfevent->fetch == lookup->fetchmasterdump.c(((dctx) != ((void *)0)) && (((const isc__magic_t *)(dctx))->magic == ((('D') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))stylep != ((void *)0) && *stylep != ((void *)0)stylep != ((void *)0) && *stylep == ((void *)0)nspaces >= 0style->tab_width != 0((*((&dctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&dctx->lock))) == 0 ? 0 : 34) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))target != ((void *)0) && *target == ((void *)0)((*((&source->lock)))++ == 0 ? 0 : 34) == 0source->references > 0source->references != 0(--(*((&source->lock))) == 0 ? 0 : 34) == 0(((rdataset) != ((void *)0)) && (((const isc__magic_t *)(rdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))result == 29could not set master file styleresult == 0length <= sizeof(ttlbuf)\-;-$NXDOMAIN ;-$NXRRSET itresult == 0$ORIGIN %.*s n <= 64trust < (sizeof(trustnames) / sizeof(trustnames[0]))buffer->length > 0$TTL %u ; %.*s $TTL %u dumping node to file: %s: open: %sdumping master file: %s: close: %sdumping master file: %s: open: %sr_hdr.length >= sizeof(dns_masterrawrdataset_t)totallen <= sizeof(dns_masterrawrdataset_t)((buffer)->length - (buffer)->used) >= (sizeof(dlen) + r.length)r.length <= 0xffffU((buffer)->used) < totallenraw master file write failed: %s$DATE %.*s ((&buffer)->used) <= sizeof(rawheader)dumptostreaminc(%p) new nodes -> %d dumping master file: %s: fsync: %sdumping master file: %s: fclose: %sdumping master file: rename: %s: %sdctxp != ((void *)0)dctx->references != 0(*((&dctx->lock)) == 0 ? (*((&dctx->lock)) = -1, 0) : 34) == 0result != (((1) << 16) + 28)task != ((void *)0)f != ((void *)0)done != ((void *)0)noneglueauthauthorityauthanswerlocal? P...@x5 (P (P (P (0PfHH 4fggggmessage.cdynbuf != ((void *)0)*rdataset == ((void *)0)(((msg) != ((void *)0)) && (((const isc__magic_t *)(msg))->magic == ((('M') << 24 | ('S') << 16 | ('G') << 8 | ('@')))))space <= msg->reserved(((section) > (-1)) && ((section) < 4))msg->cursors[section] != ((void *)0)name != ((void *)0) && *name == ((void *)0)msg != ((void *)0)msg->from_to_wire == 2(((fromsection) > (-1)) && ((fromsection) < 4))(((tosection) > (-1)) && ((tosection) < 4))(msg->sections[fromsection]).tail == (name)(msg->sections[fromsection]).head == (name)(msg->sections[section]).tail == (name)(msg->sections[section]).head == (name)item != ((void *)0) && *item != ((void *)0)owner == ((void *)0) || *owner == ((void *)0)(((*buffer) != ((void *)0)) && (((const isc__magic_t *)(*buffer))->magic == (0x42756621U)))opcode < 16target != ((void *)0)(((section) >= (-1)) && ((section) < 3));; OPT PSEUDOSECTION: ; EDNS: version: , flags: do; MBZ: %.4x , udp: ; udp: ; NSID; OPT= (;; TSIG PSEUDOSECTION: ;; SIG0 PSEUDOSECTION: (((section) >= (-1)) && ((section) < 4));; SECTION: ;;; ->>HEADER<<- opcode: , status: %4u, id: %6u ;; flags: qr aa tc rd ra ad cd ; QUESTION: ; ZONE: %1u, ANSWER: , PREREQ: , AUTHORITY: , UPDATE: , ADDITIONAL: msg->saved.base != ((void *)0)signer != ((void *)0)msg->from_to_wire == 1result != 0querytsig != ((void *)0) && *querytsig == ((void *)0)!dns_rdataset_isassociated(*item)dns_rdataset_isassociated(msg->opt)dns_rdataset_isassociated(msg->tsig)msg->namepool != ((void *)0)msg->querytsig == ((void *)0)dns_rdataset_isassociated(msg->sig0)(msg->sections[i]).tail == (name)(msg->sections[i]).head == (name)(name->list).tail == (rds)(name->list).head == (rds)dns_rdataset_isassociated(rds)source != ((void *)0)item != ((void *)0) && *item == ((void *)0)(msg->freerdatalist).tail == (rdatalist)(msg->freerdatalist).head == (rdatalist)(msg->freerdata).tail == (rdata)(msg->freerdata).head == (rdata)*name == ((void *)0)msg->state == (-1)msg->sig0key == ((void *)0) && msg->tsigkey == ((void *)0)msg->tsigkey == ((void *)0) && msg->sig0key == ((void *)0)opt->type == ((dns_rdatatype_t)dns_rdatatype_opt)(msg->flags & 0x8000U) == 0msg->buffer == ((void *)0)r.length >= 12msg->counts[0] < 65536 && msg->counts[1] < 65536 && msg->counts[2] < 65536 && msg->counts[3] < 65536msg->buffer != ((void *)0)(((sectionid) > (-1)) && ((sectionid) < 4))st.used < 65536rn.length > r.lengthtrysize != 0dns_rdatalist_tordataset(rdatalist, rdataset) == 0free_name == isc_boolean_falsefree_rdataset == isc_boolean_false!dns_rdataset_isassociated(rdataset)message has %u byte(s) of trailing garbage(msg->scratchpad).tail == (dynbuf)(msg->scratchpad).head == (dynbuf)(msg->rdatas).tail == (msgblock)(msg->rdatas).head == (msgblock)(msg->rdatalists).tail == (msgblock)(msg->rdatalists).head == (msgblock)(msg->offsets).tail == (msgblock)(msg->offsets).head == (msgblock)(msg->cleanup).tail == (dynbuf)(msg->cleanup).head == (dynbuf)isc_mempool_getallocated(msg->namepool) == 0isc_mempool_getallocated(msg->rdspool) == 0msgp != ((void *)0)(((*msgp) != ((void *)0)) && (((const isc__magic_t *)(*msgp))->magic == ((('M') << 24 | ('S') << 16 | ('G') << 8 | ('@')))))intent == 1 || intent == 2*msgp == ((void *)0)msg:namesmsg:rdataset(m->scratchpad).tail == (dynbuf)(m->scratchpad).head == (dynbuf)QUESTIONANSWERAUTHORITYADDITIONALZONEPREREQUISITEP9X9`9h9t9|999999999999: ::$:,:4:@:H:P:X:99999`:v vv v,v4v|9 vname.c(((name) != ((void *)0)) && (((const isc__magic_t *)(name))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(buffer != ((void *)0) && name->buffer == ((void *)0)) || (buffer == ((void *)0))name->labels > 0name->attributes & 0x0001n <= 63count <= 63(((name1) != ((void *)0)) && (((const isc__magic_t *)(name1))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(((name2) != ((void *)0)) && (((const isc__magic_t *)(name2))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(name1->attributes & 0x0001) == (name2->attributes & 0x0001)name1->labels > 0(name1->attributes & 0x0001) != 0name2->labels > 0(name2->attributes & 0x0001) != 0count1 <= 63 && count2 <= 63l1 == l2name->labels <= 128nlabels < 128offset <= lengthset_name == namenlabels == name->labelsoffset == name->length(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))first <= source->labelsfirst + n <= source->labels((target->attributes & (0x0002|0x0004)) == 0)n < name->labelslabel != ((void *)0)orderp != ((void *)0)nlabelsp != ((void *)0)(((wname) != ((void *)0)) && (((const isc__magic_t *)(wname))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))dns_name_iswildcard(wname)suffixlabels > 0suffixlabels < name->labelsprefix != ((void *)0) || suffix != ((void *)0)prefix == ((void *)0) || ((((prefix) != ((void *)0)) && (((const isc__magic_t *)(prefix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n'))))) && prefix->buffer != ((void *)0) && ((prefix->attributes & (0x0002|0x0004)) == 0))suffix == ((void *)0) || ((((suffix) != ((void *)0)) && (((const isc__magic_t *)(suffix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n'))))) && suffix->buffer != ((void *)0) && ((suffix->attributes & (0x0002|0x0004)) == 0))((name->attributes & (0x0002|0x0004)) == 0)(((dest) != ((void *)0)) && (((const isc__magic_t *)(dest))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))target != ((void *)0) || dest->buffer != ((void *)0)((dest->attributes & (0x0002|0x0004)) == 0)(name->attributes & 0x0004) != 0source->length > 0target->offsets == ((void *)0)prefix == ((void *)0) || (((prefix) != ((void *)0)) && (((const isc__magic_t *)(prefix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))suffix == ((void *)0) || (((suffix) != ((void *)0)) && (((const isc__magic_t *)(suffix))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))name == ((void *)0) || (((name) != ((void *)0)) && (((const isc__magic_t *)(name))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('n')))))(target != ((void *)0) && (((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == (0x42756621U)))) || (target == ((void *)0) && name != ((void *)0) && (((name->buffer) != ((void *)0)) && (((const isc__magic_t *)(name->buffer))->magic == (0x42756621U))))!copy_suffixname->buffer != ((void *)0)(((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == (0x42756621U)))(name->attributes & 0x0002) == 0(target != ((void *)0) && (((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == (0x42756621U)))) || (target == ((void *)0) && (((name->buffer) != ((void *)0)) && (((const isc__magic_t *)(name->buffer))->magic == (0x42756621U))))nlen >= countUnexpected label type %02xdigest != ((void *)0)Unknown state %d(name->attributes & 0x0001) != 0%%%02X(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == (0x42756621U)))labels <= 127Unexpected state %dtlen == 0count != 0n2 <= 63  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  ANYCHHSINNONERESERVED0CLASS%uanychaoshshesiodreserved0rcode.cbuffer[source->length] == '\0'NOCONFNOAUTHNOKEYFLAG2EXTENDFLAG4FLAG5USERHOSTNTYP3FLAG8FLAG9FLAG10FLAG11SIG0SIG1SIG2SIG3SIG4SIG5SIG6SIG7SIG8SIG9SIG10SIG11SIG12SIG13SIG14SIG15KSKTLSEMAILDNSSECIPSECALLRSAMD5RSADHDSAECCRSASHA1INDIRECTPRIVATEDNSPRIVATEOIDPKIXSPKIPGPURIOIDBADSIGBADKEYBADTIMEBADMODEBADNAMEBADALGBADTRUNC%d %d %d.%03d %s %d %d %d.%03d %s %s%ld.%02ldm %s %s %s./rdata/in_1/apl_42.capl != ((void *)0)apl->common.rdtype == 42apl->common.rdclass == 1apl->apl != ((void *)0) || apl->apl_len == 0apl->apl_len > 3Ulength <= apl->apl_lenapl->offset < apl->apl_lenapl->offset <= apl->apl_len - 4Ulength + apl->offset <= apl->apl_lenapl->offset <= apl->apl_lenrdata.crdata != ((void *)0)!((void *)((rdata)->link.prev) != (void *)(-1))(((rdata)->flags & ~0x0001) == 0)src != ((void *)0)(((src)->flags & ~0x0001) == 0)(((target)->flags & ~0x0001) == 0)region->length >= 4region->length >= 2region->length >= 1./rdata/generic/sig_24.crdata->type == 24./rdata/generic/hinfo_13.chinfo->common.rdtype == typehinfo->common.rdclass == rdclass./rdata/generic/null_10.cnull->common.rdtype == typenull->common.rdclass == rdclassnull->data != ((void *)0) || null->length == 0MDMFCNAMEMBMGMRNULLWKSPTRHINFOMINFOMXTXTRPAFSDBX25ISDNRTNSAPNSAP-PTRSIGKEYPXGPOSAAAALOCNXTEIDNIMLOCSRVATMANAPTRKXCERTA6DNAMEOPTAPLDSSSHFPIPSECKEYRRSIGNSECDNSKEYDHCIDSPFUINFOUIDGIDUNSPECTKEYTSIGIXFRMAILBMAILATYPE%un + 1 <= source->length_r->length >= _lmdmfcnamemxmbmgmrminfonullkxwksptrnaptrhinfotxtrpafsdbx25isdnnsapuidnsap-ptrsigdlvpxgposaaaaatmalocnxteidnimlocsrvcerta6dnameoptaplsshfpipseckeyrrsigdnskeydhcidspfuinfogidunspecmailbmailaadd != ((void *)0)./rdata/generic/mx_15.c./rdata/generic/afsdb_18.c./rdata/generic/rt_21.c./rdata/in_1/srv_33.c./rdata/in_1/naptr_35.c./rdata/in_1/kx_36.c./rdata/generic/ptr_12.crdata->type == 12./rdata/generic/soa_6.c./rdata/generic/minfo_14.c./rdata/in_1/a6_38.c./rdata/any_255/tsig_250.crdata->rdclass == 250rdata->type == 35rdata->rdclass == 1rdata->type == 33./rdata/generic/nxt_30.crdata->type == 30./rdata/in_1/px_26.crdata->type == 26rdata->type == 21rdata->type == 18./rdata/generic/rp_17.crdata->type == 17rdata->type == 15rdata->type == 14./rdata/generic/mr_9.crdata->type == 9./rdata/generic/mg_8.crdata->type == 8./rdata/generic/mb_7.crdata->type == 7rdata->type == 6./rdata/generic/cname_5.crdata->type == 5./rdata/generic/mf_4.crdata->type == 4./rdata/generic/md_3.crdata->type == 3./rdata/generic/ns_2.crdata->type == 2./rdata/ch_3/a_1.crdata->type == 1rdata->rdclass == ((dns_rdataclass_t)dns_rdataclass_ch)./rdata/generic/sshfp_44.csshfp != ((void *)0)sshfp->common.rdtype == 44./rdata/generic/ds_43.cds != ((void *)0)ds->common.rdtype == 43./rdata/generic/opt_41.copt->common.rdtype == 41./rdata/generic/cert_37.ccert != ((void *)0)cert->common.rdtype == 37naptr->common.rdclass == 1naptr->common.rdtype == 35nxt->common.rdtype == 30./rdata/generic/gpos_27.cgpos->common.rdtype == 27./rdata/generic/key_25.ckey->common.rdtype == 25sig->common.rdtype == 24./rdata/in_1/nsap_22.cnsap->common.rdclass == 1nsap->common.rdtype == 22./rdata/generic/isdn_20.c./rdata/generic/x25_19.cx25->common.rdtype == 19./rdata/generic/txt_16.ctxt->common.rdtype == 16./rdata/in_1/wks_11.cwks->common.rdtype == 11wks->common.rdclass == 1null->common.rdtype == 10a6->common.rdclass == 1a6->common.rdtype == 38./rdata/in_1/a_1.ca->common.rdtype == 1a->common.rdclass == 1md->common.rdtype == 3mf->common.rdtype == 4soa->common.rdtype == 6mg->common.rdtype == 8mr->common.rdtype == 9ptr->common.rdtype == 12minfo->common.rdtype == 14mx->common.rdtype == 15rp->common.rdtype == 17afsdb->common.rdtype == 18rt->common.rdtype == 21./rdata/in_1/nsap-ptr_23.cnsap_ptr->common.rdclass == 1nsap_ptr->common.rdtype == 23px->common.rdclass == 1px->common.rdtype == 26./rdata/in_1/aaaa_28.caaaa->common.rdclass == 1aaaa->common.rdtype == 28./rdata/generic/loc_29.cloc->common.rdtype == 29srv->common.rdclass == 1srv->common.rdtype == 33kx->common.rdclass == 1kx->common.rdtype == 36./rdata/generic/dname_39.cdname->common.rdtype == 39./rdata/generic/ipseckey_45.cipseckey->common.rdtype == 45./rdata/generic/rrsig_46.csig->common.rdtype == 46./rdata/generic/nsec_47.cnsec->common.rdtype == 47./rdata/generic/dnskey_48.cdnskey->common.rdtype == 48./rdata/in_1/dhcid_49.cdhcid->common.rdtype == 49dhcid->common.rdclass == 1./rdata/generic/spf_99.ctxt->common.rdtype == 99./rdata/generic/unspec_103.cunspec->common.rdtype == 103./rdata/generic/tkey_249.ctsig->common.rdclass == 255tsig->common.rdtype == 250./rdata/generic/dlv_32769.cdlv->common.rdtype == 32769rdata->type == 23rdata->length != 0rdata->type == 32769rdata->type == 250rdata->rdclass == 255sr.length >= 6sr.length >= tsig->siglensr.length == tsig->otherlenrdata->type == 249rdata->type == 103rdata->type == 99rdata->type == 49rdata->type == 48rdata->type == 47rdata->type == 46rdata->type == 45rdata->length >= 3rdata->type == 44rdata->type == 43rdata->type == 42rdata->type == 41rdata->type == 37naptr->flags_len <= r.lengthnaptr->service_len <= r.lengthnaptr->regexp_len <= r.lengthrdata->type == 27rdata->type == 25rdata->type == 22rdata->type == 20rdata->type == 19rdata->type == 16rdata->type == 13rdata->type == 11rdata->type == 10rdata->type == 38r.length >= octetsrdata->length == 4./rdata/hs_4/a_1.crdata->length == 16r.length == 16loc->common.rdtype == typeloc->common.rdclass == rdclassa->common.rdtype == typea->common.rdclass == rdclasstype == 47nsec->common.rdtype == typensec->common.rdclass == rdclassnsec->typebits != ((void *)0) || nsec->len == 0i + 2 <= nsec->lenfirst || window > lastwindowlen > 0 && len <= 32i + len <= nsec->lennsec->typebits[i + len - 1] != 0!firsttype == 45ipseckey->common.rdtype == typeipseckey->common.rdclass == rdclassdname->common.rdtype == typedname->common.rdclass == rdclassa6->common.rdtype == typea6->common.rdclass == rdclassnxt->common.rdtype == typenxt->common.rdclass == rdclassnxt->typebits != ((void *)0) || nxt->len == 0nxt->len <= 16nxt->typebits[nxt->len - 1] != 0nsap_ptr->common.rdtype == typensap_ptr->common.rdclass == rdclassrp->common.rdtype == typerp->common.rdclass == rdclassminfo->common.rdtype == typeminfo->common.rdclass == rdclassptr->common.rdtype == typeptr->common.rdclass == rdclassmr->common.rdtype == typemr->common.rdclass == rdclassmg->common.rdtype == typemg->common.rdclass == rdclassmb->common.rdtype == typemb->common.rdclass == rdclasssoa->common.rdtype == typesoa->common.rdclass == rdclasscname->common.rdtype == typecname->common.rdclass == rdclassmf->common.rdtype == typemf->common.rdclass == rdclassmd->common.rdtype == typemd->common.rdclass == rdclassns->common.rdtype == typens->common.rdclass == rdclasstype == 32769dlv->common.rdtype == typedlv->common.rdclass == rdclassdlv->length == 20Udlv->length == 32Utsig->common.rdclass == rdclasstsig->common.rdtype == typetkey->common.rdtype == typetkey->common.rdclass == rdclasstype == 48dnskey->common.rdtype == typednskey->common.rdclass == rdclasstype == 46sig->common.rdtype == typesig->common.rdclass == rdclasssig->signature != ((void *)0) || sig->siglen == 0type == 43ds->common.rdtype == typeds->common.rdclass == rdclassds->length == 20Uds->length == 32Ucert->common.rdtype == typecert->common.rdclass == rdclasskx->common.rdtype == typekx->common.rdclass == rdclassnaptr->common.rdtype == typenaptr->common.rdclass == rdclassnaptr->flags != ((void *)0) || naptr->flags_len == 0naptr->service != ((void *)0) || naptr->service_len == 0naptr->regexp != ((void *)0) || naptr->regexp_len == 0srv->common.rdtype == typesrv->common.rdclass == rdclasspx->common.rdtype == typepx->common.rdclass == rdclasskey->common.rdtype == typekey->common.rdclass == rdclassrt->common.rdtype == typert->common.rdclass == rdclassafsdb->common.rdclass == rdclassafsdb->common.rdtype == typemx->common.rdtype == typemx->common.rdclass == rdclasswks->common.rdtype == typewks->common.rdclass == rdclasswks->map != ((void *)0) || wks->map_len == 0x25->common.rdtype == typex25->common.rdclass == rdclassx25->x25 != ((void *)0) && x25->x25_len != 0type == 42apl->common.rdtype == typeapl->common.rdclass == rdclasstxt->common.rdtype == typetxt->common.rdclass == rdclasstxt->txt != ((void *)0) && txt->txt_len != 0isdn->common.rdtype == typeisdn->common.rdclass == rdclassnsap->common.rdtype == typensap->common.rdclass == rdclassnsap->nsap != ((void *)0) || nsap->nsap_len == 0gpos->common.rdtype == typegpos->common.rdclass == rdclassaaaa->common.rdtype == typeaaaa->common.rdclass == rdclassopt->common.rdtype == typeopt->common.rdclass == rdclassopt->options != ((void *)0) || opt->length == 0sshfp->common.rdtype == typesshfp->common.rdclass == rdclassdhcid->common.rdtype == typedhcid->common.rdclass == rdclassdhcid->length != 0unspec->common.rdtype == typeunspec->common.rdclass == rdclassunspec->data != ((void *)0) || unspec->datalen == 0%u )rdata->type == 29%lum0.%02lumW0x%02xrdata->length >= 5i + 2 <= sr.lengthi + len <= sr.lengthrdata->type == 39prefixlen <= 128rdata->type == 36%onumlen > 0 && numlen < sizeof("2147483647") ; ( ; %u %u %un < sizeof(buf)%u %ur.length >= length ; key id = n <= sr.length ) %lu tctx->origin == ((void *)0) || dns_name_isabsolute(tctx->origin) == isc_boolean_truerdata->length == 0sr.length >= 4!%s%s%u:n < (int)sizeof(txt)len <= 4prefix <= 32len <= 16prefix <= 128/%ux %d %x %x %x\# sr.length < 65536 ( UNKNOWN%s:%lu: "%s" is not a decimal dotted quad%s: %s:%lu: near eol: %sdns_rdata_fromtext%s: %s:%lu: near eof: %s%s: %s:%lu: near %lu: %s%s: %s:%lu: near '%s': %s%s: %s:%lu: %sdns_rdata_fromtext: %s:%lu: %s%s:%u: warning: %s: %s%s:%u: warning: '%s': %sudptype == 99%s: %s:%u: '%s' extra precision digits ignoredtype == 103%s:%lu: file does not end with newlinetarget->used < 65536activelength < 65536origin == ((void *)0) || dns_name_isabsolute(origin) == isc_boolean_truecallbacks->warn != ((void *)0)callbacks->error != ((void *)0)\#rdata1->type == rdata2->typerdata1->rdclass == rdata2->rdclassrdata1->type == 41rdata1->type == 37rdata1->length != 0rdata2->length != 0rdata1->type == 29rdata1->type == 28rdata1->rdclass == 1rdata1->length == 16rdata2->length == 16rdata1->type == 27rdata1->type == 25rdata1->type == 22rdata1->type == 20rdata1->type == 19rdata1->type == 16rdata1->type == 13rdata1->type == 11rdata1->type == 10rdata1->type == 1rdata1->length == 4rdata2->length == 4rdata1->type == 250rdata1->rdclass == 255rdata1->type == 249rdata1->type == 39rdata1->type == 30rdata1->type == 24r1.length > 18r2.length > 18rdata1->type == 23rdata1->type == 17rdata1->type == 14rdata1->type == 12rdata1->type == 9rdata1->type == 8rdata1->type == 7rdata1->type == 6rdata1->type == 5rdata1->type == 4rdata1->type == 3rdata1->type == 2rdata1->type == 38rdata1->type == 36rdata1->type == 35rdata1->type == 33rdata1->type == 26rdata1->type == 21rdata1->type == 18rdata1->type == 15rdata1->rdclass == 4rdata1->rdclass == ((dns_rdataclass_t)dns_rdataclass_ch)rdata1 != ((void *)0)rdata2 != ((void *)0)rdata1->data != ((void *)0)rdata2->data != ((void *)0)(((rdata1)->flags & ~0x0001) == 0)(((rdata2)->flags & ~0x0001) == 0)rdata1->length >= 3rdata2->length >= 3serialrefreshexpireminimumnSND$$nSND$ $nSND$ $4 ( d'@B!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstu01234567890123456789abcdef d'@Brdatalist.crdatalist != ((void *)0) && rdataset != ((void *)0)(rdataset->attributes & 0x00004000) != 0list_rdata != ((void *)0)rdatalist != ((void *)0)! dns_rdataset_isassociated(rdataset)rdataset.crdataset->methods == ((void *)0)rdataset->methods != ((void *)0)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))source->methods != ((void *)0)(((target) != ((void *)0)) && (((const isc__magic_t *)(target))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))target->methods == ((void *)0)zonep == ((void *)0) || *zonep == ((void *)0)dbp != ((void *)0) && *dbp == ((void *)0)versionp != ((void *)0) && *versionp == ((void *)0)nodep != ((void *)0) && *nodep == ((void *)0)fname != ((void *)0)(rdataset->attributes & 0x00000001) == 0countp != ((void *)0)(order == ((void *)0)) == (order_arg == ((void *)0))cctx != ((void *)0) && cctx->mctx != ((void *)0)i < counti == countorder != ((void *)0)(target->used >= rdlen.used + 2) && (target->used - rdlen.used - 2 < 65536)rrbuffer.used < 65536savedbuffer.used < 65536state == ((void *)0)rdatasetiter.citeratorp != ((void *)0)(((*iteratorp) != ((void *)0)) && (((const isc__magic_t *)(*iteratorp))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('i')))))(((iterator) != ((void *)0)) && (((const isc__magic_t *)(iterator))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('i')))))%s %s%s%sresolving '%s/%s/%s': %sresolver.c(((res) != ((void *)0)) && (((const isc__magic_t *)(res))->magic == ((('R') << 24 | ('e') << 16 | ('s') << 8 | ('!')))))!res->frozen(((resolver) != ((void *)0)) && (((const isc__magic_t *)(resolver))->magic == ((('R') << 24 | ('e') << 16 | ('s') << 8 | ('!')))))ndisps > 0(res->options & 0x04) != 0 || (res->options & 0x08) != 0res->dispatchv4 != ((void *)0)result == 0 && isc_sockaddr_getport(&addr4) == 0res->dispatchv6 != ((void *)0)result == 0 && isc_sockaddr_getport(&addr6) == 0((*((&resolver->lock)))++ == 0 ? 0 : 34) == 0(--(*((&resolver->lock))) == 0 ? 0 : 34) == 0((*((&resolver->nlock)))++ == 0 ? 0 : 34) == 0(--(*((&resolver->nlock))) == 0 ? 0 : 34) == 0((*((&res->lock)))++ == 0 ? 0 : 34) == 0(--(*((&res->lock))) == 0 ? 0 : 34) == 0((*((&res->poollock)))++ == 0 ? 0 : 34) == 0(--(*((&res->poollock))) == 0 ? 0 : 34) == 0could not update an IPv4 random query port: %scould not update an IPv6 random query port: %s(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('R') << 24 | ('e') << 16 | ('s') << 8 | ('!')))))targetp != ((void *)0) && *targetp == ((void *)0)res %p: %sattach!source->exiting!resolver->frozen(alt == ((void *)0)) ^ (name == ((void *)0))(((fctx) != ((void *)0)) && (((const isc__magic_t *)(fctx))->magic == ((('F') << 24 | ('!') << 16 | ('!') << 8 | ('!')))))fctx->state == fetchstate_done || fctx->state == fetchstate_init(((fctx->events).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->queries).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->finds).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->altfinds).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)fctx->pending == 0fctx->references == 0(((fctx->validators).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)fctx %p(%s'): %s(res->buckets[bucketnum].fctxs).tail == (fctx)(res->buckets[bucketnum].fctxs).head == (fctx)(fctx->bad).tail == (sa)(fctx->bad).head == (sa)(fctx->edns).tail == (sa)(fctx->edns).head == (sa)(fctx->edns512).tail == (sa)(fctx->edns512).head == (sa)((*((&res->nlock)))++ == 0 ? 0 : 34) == 0(--(*((&res->nlock))) == 0 ? 0 : 34) == 0shutdown(((fetch) != ((void *)0)) && (((const isc__magic_t *)(fetch))->magic == ((('F') << 24 | ('t') << 16 | ('c') << 8 | ('h')))))fetch %p (fctx %p(%s)): %scancelfetch((*((&res->buckets[fctx->bucketnum].lock)))++ == 0 ? 0 : 34) == 0(fctx->events).tail == (event)(fctx->events).head == (event)(--(*((&res->buckets[fctx->bucketnum].lock))) == 0 ? 0 : 34) == 0(res->whenshutdown).tail == (event)(res->whenshutdown).head == (event)empty_bucketres->activebuckets > 0fetchp != ((void *)0)destroyfetch((*((&res->buckets[bucketnum].lock)))++ == 0 ? 0 : 34) == 0event->fetch != fetchfctx->references > 0(--(*((&res->buckets[bucketnum].lock))) == 0 ? 0 : 34) == 0!res->exitingclients-per-query decreased to %usendeventsresult != 0 || dns_rdataset_isassociated(event->rdataset) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_any) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_rrsig) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_sig)event->result == (((1) << 16) + 51) || event->result == (((1) << 16) + 52)((*((&fctx->res->lock)))++ == 0 ? 0 : 34) == 0(--(*((&fctx->res->lock))) == 0 ? 0 : 34) == 0clients-per-query increased to %uexiting((*((&res->buckets[i].lock)))++ == 0 ? 0 : 34) == 0(--(*((&res->buckets[i].lock))) == 0 ? 0 : 34) == 0(((fctx)->attributes & 0x0008) != 0)(fctx->validators).tail == (validator)(fctx->validators).head == (validator)queryp != ((void *)0)!((void *)((query)->link.prev) != (void *)(-1))query->tcpsocket == ((void *)0)cancelquery!(((query)->attributes & 0x02) != 0)no_response(fctx->queries).tail == (query)(fctx->queries).head == (query)cancelqueries(fctx->altfinds).tail == (find)(fctx->altfinds).head == (find)(fctx->finds).tail == (find)(fctx->finds).head == (find)(fctx->altaddrs).tail == (addr)(fctx->altaddrs).head == (addr)(fctx->forwaddrs).tail == (addr)(fctx->forwaddrs).head == (addr)stopeverythingisc_timer_reset(): %sdoshutdownfctx->state == fetchstate_active || fctx->state == fetchstate_donefctx->want_shutdown(find->options & 0x00000008) == 0(find->list).tail == (best)(find->list).head == (best)ignoring blackholed / bogus server: ignoring multicast address: ignoring experimental address: ignoring IPv6 mapped IPV4 address: ignoring IPv6 compatibility IPV4 address: fctx %p(%s): %s %sresquery %p (fctx %p(%s)): %ssendtoo many timeouts resolving '%s' (in '%s'?): disabling EDNStoo many timeouts, setting EDNS size to 512noanswer_responsereferral to non-parentns_rdataset != ((void *)0)dns_name_countlabels(&fctx->domain) > 0clone_resultshevent->rdataset != ((void *)0)event->rdataset != ((void *)0)! (hevent->sigrdataset == ((void *)0) && event->sigrdataset != ((void *)0))add_bad() isc_time_now((&query->start)) == 0query->dispatch != ((void *)0)connecting via TCPfctx_starttimer(fctx) == 0!(((fctx)->attributes & 0x0004) != 0)getaddressestoo many restarts(((fctx->forwaddrs).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((fctx->altaddrs).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)no addressesbestaddrinfo != ((void *)0)(fctx->finds).tail == (best)(fctx->finds).head == (best)(fctx->altfinds).tail == (best)(fctx->altfinds).head == (best)addrwaitevent->ev_type == (((4) << 16) + 19)!(((fctx->validators).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)received validation completion event(fctx->validators).tail == (vevent->validator)(fctx->validators).head == (vevent->validator)((*((&fctx->res->buckets[fctx->bucketnum].lock)))++ == 0 ? 0 : 34) == 0vevent->rdataset->type == ((dns_rdatatype_t)dns_rdatatype_dname)validation failed(--(*((&fctx->res->buckets[fctx->bucketnum].lock))) == 0 ? 0 : 34) == 0fctx->validator == ((void *)0)nonexistence validation OKvalidation OKvevent->sigrdataset != ((void *)0)fctx->type == ((dns_rdatatype_t)dns_rdatatype_any) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_rrsig) || fctx->type == ((dns_rdatatype_t)dns_rdatatype_sig)dns_name_copy(vevent->name, (&((&hevent->foundname)->name)), ((void *)0)) == 0fctx->state == fetchstate_initfctx->nqueries == 0finddonefctx->pending > 0!(((fctx)->attributes & 0x0008) != 0)(((query) != ((void *)0)) && (((const isc__magic_t *)(query))->magic == ((('Q') << 24 | ('!') << 16 | ('!') << 8 | ('!')))))connectedsenddone((query)->sends > 0)(valoptions & 2U) != 0cache_messagecheck-names %s %s/%s/%svalrdataset == ((void *)0) && valsigrdataset == ((void *)0)eresult == (((1) << 16) + 51) || eresult == (((1) << 16) + 52)warningeventp != ((void *)0)res->frozen(((nameservers) != ((void *)0)) && (((const isc__magic_t *)(nameservers))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R')))))nameservers->type == ((dns_rdatatype_t)dns_rdatatype_ns)nameservers == ((void *)0)forwarders == ((void *)0)sigrdataset == ((void *)0) || !dns_rdataset_isassociated(sigrdataset)fetchp != ((void *)0) && *fetchp == ((void *)0)createfetch: %s %sfctx != ((void *)0)/dns_name_issubdomain(&fctx->name, &fctx->domain)isc_time_nowplusinterval: %sisc_timer_create: %sjoindns_resolver_primeres->primefetch == ((void *)0)primingres->priming((*((&res->primelock)))++ == 0 ? 0 : 34) == 0(--(*((&res->primelock))) == 0 ? 0 : 34) == 0event->ev_type == (((4) << 16) + 6)isc_time_now((&tnow)) == 0received packet: %.*sreceived NSID '%s' from %s(message->flags & 0x8000U) != 0((rdataset)->link.next) == ((void *)0)lame server resolving '%s' (in '%s'?): %scould not mark server as lame: %senforced delegation-only for '%s' (%s/%s/%s) from %sanswer_response!externalncache_messagefctx->rmessage->counts[1] == 0couldn't find a zonecutnameservers now above QDOMAINresendwait for validatorsuspending DS lookup to find parent's NS recordsresume_dslookupresuming DS lookupcontinuing to look for parent's NS recordsfevent->sigrdataset == ((void *)0)resp != ((void *)0)detachres->references > 0res->exiting && res->activebuckets == 0res->references == 0!res->primingres->nfctx == 0(*((&res->poollock)) == 0 ? (*((&res->poollock)) = -1, 0) : 34) == 0(*((&res->primelock)) == 0 ? (*((&res->primelock)) = -1, 0) : 34) == 0(*((&res->nlock)) == 0 ? (*((&res->nlock)) = -1, 0) : 34) == 0(*((&res->lock)) == 0 ? (*((&res->lock)) = -1, 0) : 34) == 0(((res->buckets[i].fctxs).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&res->buckets[i].lock)) == 0 ? (*((&res->buckets[i].lock)) = -1, 0) : 34) == 0(res->alternates).tail == (a)(res->alternates).head == (a)(((view) != ((void *)0)) && (((const isc__magic_t *)(view))->magic == ((('V') << 24 | ('i') << 16 | ('e') << 8 | ('w')))))ntasks > 0resp != ((void *)0) && *resp == ((void *)0)dispatchmgr != ((void *)0)dispatchv4 != ((void *)0) || dispatchv6 != ((void *)0)res%u0123456789abcdefisc_result_register() failed: %ulabel too longbad escapebad bitstringbitstring too longempty labelbad dotted quadinvalid NS owner name (wildcard)unknown class/typebad label typebad compression pointertoo many hopsdisallowed (by application policy)extra input textextra input datatext too longnot at top of zonesyntax errorbad checksumbad IPv6 addressno ownerno ttlbad classname too longpartial matchnew originunchangedbad ttlmore data needed/to be renderedcontinuedelegationbad databasebad zonemore datatsig verify failuretsig indicates errorRRSIG failed to verifyRRSIG has expiredRRSIG validity period has not begunkey is unauthorized to sign datainvalid timeexpected a TSIG or SIG(0)did not expect a TSIG or SIG(0)TKEY is unacceptablehintdropzone not loadedncache nxdomainncache nxrrsetnot verified yetno identityno journalaliasuse TCPno valid RRSIGno valid NSECnot insecureunknown servicerecoverable error occurredunknown opt attribute recordunexpected message idseen include filenot exactaddress blackholedbad algorithminvalid use of a meta typeCNAME and other datamultiple RRs of singleton typehint nxrrsetno master file configuredunknown protocolclocks are unsynchronizedIXFR failednot authoritativeno valid KEYobsoletealready frozenunknown flagexpected a responseno valid DSNS is an addressreceived FORMERRtruncated TCP responselame server detectedunexpected RCODEunexpected OPCODEchase DS serversempty nameempty wildbad bitmapfrom wildcardbad owner name (check-names)bad name (check-names)dynamic zoneunknown commandmust-be-securecovering NSEC record returnedMX is an addressduplicate query_default: view rootns.ccheckhints%s%s: %s/%s (%s) missing from hintscheckhints%s%s: %s/%s (%s) extra record in hints_bindhints != ((void *)0)checkhints%s%s: unable to get root NS rrset from hints: %scheckhints%s%s: unable to get root NS rrset from cache: %scheckhints%s%s: unable to find root NS '%s' in hintscheckhints%s%s: extra NS '%s' in hintsextra data in root hints '%s'stats.c(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_generalcounter < stats->ncounters(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_rdtype(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_rdataset(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t'))))) && stats->type == dns_statstype_opcodei < stats->ncounters(((stats) != ((void *)0)) && (((const isc__magic_t *)(stats))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t')))))statsp != ((void *)0) && *statsp == ((void *)0)((*((&stats->lock)))++ == 0 ? 0 : 34) == 0(--(*((&stats->lock))) == 0 ? 0 : 34) == 0(*((&stats->lock)) == 0 ? (*((&stats->lock)) = -1, 0) : 34) == 0statsp != ((void *)0) && (((*statsp) != ((void *)0)) && (((const isc__magic_t *)(*statsp))->magic == ((('D') << 24 | ('s') << 16 | ('t') << 8 | ('t')))))referralnxrrsetnxdomainrecursionduplicatedropped%4d%2d%2d%2d%2d%2dtime.c%04d%02d%02d%02d%02d%02dtsig.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))(&source->refs)->refs > 0ringp != ((void *)0)*ringp != ((void *)0)*ringp == ((void *)0)(((key) != ((void *)0)) && (((const isc__magic_t *)(key))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))key->ring != ((void *)0)isc_rwlock_lock((&key->ring->lock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&key->ring->lock), (isc_rwlocktype_write)) == 0tsig key '%s' (%s): %stsig key '%s': %stsig expire: generated=%d, refs=%d, expire=%d)tsig expire: deletingtsigkey != ((void *)0)*tsigkey == ((void *)0)ring != ((void *)0)isc_rwlock_lock((&ring->lock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&ring->lock), (isc_rwlocktype_write)) == 0isc_rwlock_lock((&ring->lock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&ring->lock), (isc_rwlocktype_read)) == 0(&key->refs)->refs > 0(((dns_message_gettsigkey(msg)) != ((void *)0)) && (((const isc__magic_t *)(dns_message_gettsigkey(msg)))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))dns_rdatalist_tordataset(datalist, dataset) == 0keyp != ((void *)0)(((*keyp) != ((void *)0)) && (((const isc__magic_t *)(*keyp))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))(&key->refs)->refs == 0node != ((void *)0)key == ((void *)0) || *key == ((void *)0)algorithm != ((void *)0)key != ((void *)0) || ring != ((void *)0)the key '%s' is too short to be secure(&tkey->refs)->refs > 0(&tkey->refs)->refs == 0length >= 0secret != ((void *)0)tsigkey == ((void *)0) || (((tsigkey) != ((void *)0)) && (((const isc__magic_t *)(tsigkey))->magic == ((('T') << 24 | ('S') << 16 | ('I') << 8 | ('G')))))dns_message_gettsigkey(msg) != ((void *)0)msg->tcp_continuation == 1msg->querytsig != ((void *)0)key name and algorithm do not matchsignature is in the futuresignature is emptysignature failed to verify(2)unknown keysignature length to bigsignature length below minimumtruncated signature length too smallsignature length too smallsignature failed to verify(1)signature was empty%s%u %s%s%u%clen + 1 <= sizeof(tmp)ttl.cnp - nbuf <= (int)sizeof(nbuf)weekdayhourminutesecondx > 0accepted expired %sRRSIG (keyid=%u)verify rdataset (keyid=%u): %svalidator.cval->event == ((void *)0)%.*svalidating @%p: %s %s: %s%.*svalidator @%p: %s%s: creating %s for %s %smarking as answer(((val)->attributes & 0x0001) != 0)val->fetch == ((void *)0)(*((&val->lock)) == 0 ? (*((&val->lock)) = -1, 0) : 34) == 0validatorp != ((void *)0)(((val) != ((void *)0)) && (((const isc__magic_t *)(val))->magic == ((('V') << 24 | ('a') << 16 | ('l') << 8 | ('?')))))((*((&val->lock)))++ == 0 ? 0 : 34) == 0dns_validator_destroy(--(*((&val->lock))) == 0 ? 0 : 34) == 0(((validator) != ((void *)0)) && (((const isc__magic_t *)(validator))->magic == ((('V') << 24 | ('a') << 16 | ('l') << 8 | ('?')))))((*((&validator->lock)))++ == 0 ? 0 : 34) == 0dns_validator_cancel(--(*((&validator->lock))) == 0 ? 0 : 34) == 0(validator->options & 2U) != 0dlv_validator_startrdataset != ((void *)0) || (rdataset == ((void *)0) && sigrdataset == ((void *)0) && message != ((void *)0))validatorp != ((void *)0) && *validatorp == ((void *)0)DNS_R_COVERINGNSECtype == ((dns_rdatatype_t)dns_rdatatype_dlv)covering nsec: trust %ucovering nsec: for parentcovering nsec: not in zonecovering nsec: not in rangecovering nsec found: '%s' '%s' '%s'continuing validation would lead to deadlock: aborting validationval->view->dlv != ((void *)0)must be secure failureDLV concatenate failedlooking for DLV %sfinddlvsep!((val->attributes & 0x0020) != 0)plain DNSSEC returns unsecure (%s): looking for DLVDLV not foundDLV lookup: %sDLV %s foundexists != ((void *)0)nsecset != ((void *)0) && nsecset->type == ((dns_rdatatype_t)dns_rdatatype_nsec)failure processing NSEC setlooking for relevant nsecNSEC does not cover name, before NSECignoring parent nsecignoring child nsecnsec proves name exists (owner) data=%dNSEC proves CNAME existsignoring nsec matches next nameignoring nsec because name is past end of rangensec proves name exist (empty)failure generating wildcard namensec range okwildcard val->key == ((void *)0)dlv_validatezonekeydns_ds_buildrdata() -> %sFound matching DLV record: checking for signaturemarking as secureno supported algorithm/digest (dlv)signed by trusted key; marking as secureunable to find a DNSKEY which verifies the DNSKEY RRset and also matches one of specified trusted-keys for '%s'unsigned DS recordno DS recordval->dsset != ((void *)0)no supported algorithm/digest (DS)no DNSKEY matching DLVno RRSIG matching DLV keyno DNSKEY matching DSno RRSIG matching DS keydbresult == (((3) << 16) + 8) || dbresult == (((1) << 16) + 52)set.type == ((dns_rdatatype_t)dns_rdatatype_nsec)not beneath secure rootresuming proveunsecuremust be secure failure at '%s'no supported algorithm/digest (%s/DS)checking existence of DS at '%s'proveunsecureinsecurity proof failedresuming nsecvalidatensecvalidatenoqname proof foundnoqname proof not foundin checkwildcard: %snonexistence proof(s) foundnonexistence proof(s) not foundresuming validateget_keykeyset with trust %dno message available for noqname prooflooking for noqname proofverify failure: %sfailed to iterate signatures: %sno valid signature foundfailed to verify rdatasetevent->ev_type == (((4) << 16) + 21)restarting using DLVstartingattempting positive response validationdns_rdataset_isassociated(val->event->rdataset)dns_rdataset_isassociated(val->event->sigrdataset)rdataset->type == ((dns_rdatatype_t)dns_rdatatype_dnskey)falling back to insecurity proofattempting insecurity proofattempting negative response validationval->event != ((void *)0)in dlvfetched: %sin authvalidatedauthvalidated: got %sin dsvalidateddsset with trust %ddsvalidated: got %sin keyvalidatedkeyvalidated: got %sin dsfetched2: %sin dsfetchedfalling back to insecurity proof (%s)dsfetched: got %sin fetch_callback_validatorfetch_callback_validator: got %s *view.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('V') << 24 | ('i') << 16 | ('e') << 8 | ('w')))))(&source->references)->refs > 0!view->frozenview->resquerystats == ((void *)0)view->resstats == ((void *)0); ; Cache dump of view '%s' ; keyp != ((void *)0) && *keyp == ((void *)0)list != ((void *)0)result == 0 || result == 23 || result == (((1) << 16) + 23)view->frozentype != ((dns_rdatatype_t)dns_rdatatype_rrsig)nodep == ((void *)0) || *nodep == ((void *)0)view->cachedb != ((void *)0)view->hints == ((void *)0)dns_db_iszone(hints)(((view->cachedb) != ((void *)0)) && (((const isc__magic_t *)(view->cachedb))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))view->resolver == ((void *)0)viewADB!((void *)((view)->link.prev) != (void *)(-1))((unsigned int)((&view->references)->refs)) == 0view->weakrefs == 0(((view)->attributes & 0x01) != 0)(((view)->attributes & 0x02) != 0)(((view)->attributes & 0x04) != 0)(view->delonly[i]).tail == (name)(view->delonly[i]).head == (name)(view->rootexclude[i]).tail == (name)(view->rootexclude[i]).head == (name)(*((&view->lock)) == 0 ? (*((&view->lock)) = -1, 0) : 34) == 0(&view->references)->refs == 0viewp != ((void *)0)((*((&view->lock)))++ == 0 ? 0 : 34) == 0view->weakrefs > 0(--(*((&view->lock))) == 0 ? 0 : 34) == 0(&view->references)->refs > 0viewp != ((void *)0) && *viewp == ((void *)0)dns_zt_create() failed: %sdns_keytable_create() failed: %sdns_fwdtable_create() failed: %sevent->ev_type == (((4) << 16) + 22)view->task == taskevent->ev_type == (((4) << 16) + 3)event->ev_type == (((4) << 16) + 2)transferred zone has %d SOA record%stransferred zone has no NS recordszone->expirezone->refresh: TSIG '%s'transferred serial %u%stransfer: could not set file modification time of '%s': %sisc_rwlock_lock((&zone->zmgr->rwlock), (isc_rwlocktype_write)) == 0(zone->zmgr->xfrin_in_progress).tail == (zone)(zone->zmgr->xfrin_in_progress).head == (zone)isc_rwlock_unlock((&zone->zmgr->rwlock), (isc_rwlocktype_write)) == 0zone.c(((zone) != ((void *)0)) && (((const isc__magic_t *)(zone))->magic == ((('Z') << 24 | ('O') << 16 | ('N') << 8 | ('E')))))((zone)->locked)((unsigned int)((&zone->erefs)->refs)) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('Z') << 24 | ('O') << 16 | ('N') << 8 | ('E')))))(&source->erefs)->refs > 0((source)->locked)source->irefs + ((unsigned int)((&source->erefs)->refs)) > 0source->irefs != 0zonep != ((void *)0) && (((*zonep) != ((void *)0)) && (((const isc__magic_t *)(*zonep))->magic == ((('Z') << 24 | ('O') << 16 | ('N') << 8 | ('E')))))((*zonep)->locked)zone->irefs > 0zone->irefs + ((unsigned int)((&zone->erefs)->refs)) > 0val > 0next != ((void *)0) && *next == ((void *)0)(((zmgr) != ((void *)0)) && (((const isc__magic_t *)(zmgr))->magic == ((('Z') << 24 | ('m') << 16 | ('g') << 8 | ('r')))))first != ((void *)0) && *first == ((void *)0)iolimit > 0((*((&(zone)->lock)))++ == 0 ? 0 : 34) == 0(zone)->locked == isc_boolean_false(--(*((&(zone)->lock))) == 0 ? 0 : 34) == 0((*((&(source)->lock)))++ == 0 ? 0 : 34) == 0(source)->locked == isc_boolean_false(--(*((&(source)->lock))) == 0 ? 0 : 34) == 0type != dns_zone_nonezone->type == dns_zone_none || zone->type == typeisc_rwlock_lock((&zmgr->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&zmgr->rwlock), (isc_rwlocktype_read)) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('Z') << 24 | ('m') << 16 | ('g') << 8 | ('r')))))isc_rwlock_lock((&source->rwlock), (isc_rwlocktype_write)) == 0source->refs > 0isc_rwlock_unlock((&source->rwlock), (isc_rwlocktype_write)) == 0%s: zone %s: %s%s/%s: %s%s/%s: %s: %s zone->stats == ((void *)0)isc_rwlock_lock((&zmgr->rwlock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&zmgr->rwlock), (isc_rwlocktype_write)) == 0(((io) != ((void *)0)) && (((const isc__magic_t *)(io))->magic == ((('Z') << 24 | ('m') << 16 | ('I') << 8 | ('O')))))((*((&io->zmgr->iolock)))++ == 0 ? 0 : 34) == 0(io->zmgr->high).tail == (io)(io->zmgr->high).head == (io)(io->zmgr->low).tail == (io)(io->zmgr->low).head == (io)io->event != ((void *)0)(--(*((&io->zmgr->iolock))) == 0 ? 0 : 34) == 0zone->statelist == &zmgr->waiting_for_xfrin(zmgr->waiting_for_xfrin).tail == (zone)(zmgr->waiting_for_xfrin).head == (zone)Transfer started.starting zone transfer: %sisc_rwlock_lock((&zmgr->rwlock), (locktype)) == 0isc_rwlock_unlock((&zmgr->rwlock), (locktype)) == 0zone != ((void *)0)NS '%s' has no address records (A or AAAA)NS '%s' is a CNAME (illegal)NS '%s' is below a DNAME '%s' (illegal)zone->db != ((void *)0)((*((&zone->dblock)))++ == 0 ? 0 : 34) == 0(--(*((&zone->dblock))) == 0 ? 0 : 34) == 0expired!isc_time_isepoch(&zone->dumptime)!isc_time_isepoch(&zone->refreshtime)!isc_time_isepoch(&zone->expiretime)settimer inactivecould not deactivate zone timer: %scould not reset zone timer: %szone_settimerentercancel_refreshepoch approaching: upgrade required: now + %s faileddns_zone_maintenancequeue_soa_query(soardataset != ((void *)0) && stub == ((void *)0)) || (soardataset == ((void *)0) && stub != ((void *)0))stub == ((void *)0) || (((stub) != ((void *)0)) && (((const isc__magic_t *)(stub))->magic == ((('S') << 24 | ('t') << 16 | ('u') << 8 | ('b')))))zone->db_argc >= 1refreshing stub: could not create database: %srefreshing stub: dns_db_findnode() failed: %srefreshing stub: dns_db_addrdataset() failed: %szone->masterscnt > 0zone->curmaster < zone->masterscntunable to find key: %sunable to add opt record: %sdns_request_createvia() failed: %sns_querydbargc >= 1dbargv != ((void *)0)zone->db == ((void *)0) && db != ((void *)0)dns_acache_setdb() failed: %siop != ((void *)0)!((void *)((io)->link.prev) != (void *)(-1))io->event == ((void *)0)((*((&zmgr->iolock)))++ == 0 ? 0 : 34) == 0zmgr->ioactive > 0(zmgr->high).tail == (next)(zmgr->high).head == (next)(zmgr->low).tail == (next)(zmgr->low).head == (next)next->event != ((void *)0)(--(*((&zmgr->iolock))) == 0 ? 0 : 34) == 0zmgr->refs == 0(((zmgr->zones).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&zmgr->iolock)) == 0 ? (*((&zmgr->iolock)) = -1, 0) : 34) == 0zmgrp != ((void *)0)zone->zmgr == zmgr(zmgr->zones).tail == (zone)(zmgr->zones).head == (zone)zone->zmgr == ((void *)0)zone->task == ((void *)0)zone->timer == ((void *)0)zone->irefs != 0iop != ((void *)0) && *iop == ((void *)0)zone_dumpnotifyp != ((void *)0) && *notifyp == ((void *)0)zmgr((*((&(forward->zone)->lock)))++ == 0 ? 0 : 34) == 0(forward->zone)->locked == isc_boolean_false(--(*((&(forward->zone)->lock))) == 0 ? 0 : 34) == 0table != ((void *)0)*table == ((void *)0)has %d SOA recordshas no NS recordsretrieving SOA and NS records failed: %sgenerating diffsixfr-from-differences: unable to get new serialixfr-from-differences: failed: new serial (%u) out of range [%u - %u]dns_journal_compact: %sdns_journal_compact failed: %sdumping new zone versionisc_time_now((&zone->loadtime)) == 0removing journal filereplacing zone databasebuf != ((void *)0)length > 1Uorigin != ((void *)0)rdclass != ((dns_rdataclass_t)dns_rdataclass_none)zone->rdclass == ((dns_rdataclass_t)dns_rdataclass_none) || zone->rdclass == rdclasscannot refresh: no mastersisc_time_nowplusinterval() failed: %sdns_zone_dialupnotify = %d, refresh = %dNOTIFY with no question section from: %sNOTIFY zone does not matchrefused notify from non-master: %snotify from %s: zone is up to datenotify from %s: refresh in progress, refresh check queuedcount == 0 || masters != ((void *)0)count == 0 || notify != ((void *)0)zone->irefs == 0!((zone)->locked)zone->readio == ((void *)0)zone->statelist == ((void *)0)zone->writeio == ((void *)0)dns_zone_setmasterswithkeys(zone, ((void *)0), ((void *)0), 0) == 0dns_zone_setalsonotify(zone, ((void *)0), 0) == 0(*((&zone->dblock)) == 0 ? (*((&zone->dblock)) = -1, 0) : 34) == 0(*((&zone->lock)) == 0 ? (*((&zone->lock)) = -1, 0) : 34) == 0(&zone->erefs)->refs == 0zone transfer finished: %s(zone->flags & 0x00000001U) != 0task == zone->taskgot_transfer_quota: skipping zone transfer as master %s (source %s) is unreachable (cached)no database exists yet, requesting AXFR of initial version from %sixfr-from-differences set, requesting AXFR from %sforced reload, requesting AXFR of initial version from %sretrying with AXFR from %s due to previous IXFR failureIXFR disabled, requesting AXFR from %srequesting IXFR from %scould not get TSIG key for zone transfer: %sisc_sockaddr_pf(&masteraddr) == isc_sockaddr_pf(&sourceaddr)callback != ((void *)0)(((forward) != ((void *)0)) && (((const isc__magic_t *)(forward))->magic == ((('F') << 24 | ('o') << 16 | ('r') << 8 | ('w')))))could not forward dynamic update to %s: %sforwarding dynamic update: unexpected response: master %s returned: %.*sexhausted dynamic update forwarder listforward_callbackdns_request_createvia2() failed: %ssoa_queryrefresh: timeout retrying without EDNS master %s (source %s)refresh: retry limit for master %s exceeded (source %s)refresh: skipped tcp fallbackas master %s (source %s) is unreachable (cached)refresh: failure trying master %s (source %s): %srefresh: rcode (%.*s) retrying without EDNS master %s (source %s)refresh: unexpected rcode (%.*s) from master %s (source %s)refresh: truncated UDP answer, initiating TCP zone xfer for master %s (source %s)zone->type == dns_zone_stubrefresh: truncated TCP response from master %s (source %s)refresh: non-authoritative answer from master %s (source %s)refresh: CNAME at top of zone in master %s (source %s)refresh: referral response from master %s (source %s)refresh: NODATA response from master %s (source %s)refresh: answer SOA count (%d) != 1 from master %s (source %s)refresh: unable to get SOA record from master %s (source %s)refresh: dns_rdataset_first() failedserial: new %u, old %uzone transferNS queryrefresh: skipping %s as master %s (source %s) is unreachable (cached)zone transfer deferred due to quotarefresh: could not set file modification time of '%s': %sserial number (%u) received from master %s < ours (%u)aheadrefresh_callbackqueue_xfrin(((stub) != ((void *)0)) && (((const isc__magic_t *)(stub))->magic == ((('S') << 24 | ('t') << 16 | ('u') << 8 | ('b')))))refreshing stub: timeout retrying without EDNS master %s (source %s)could not refresh stub from master %s (source %s): %srefreshing stub: rcode (%.*s) retrying without EDNS master %s (source %s)refreshing stub: unexpected rcode (%.*s) from %s (source %s)refreshing stub: truncated TCP response from master %s (source %s)refreshing stub: non-authoritative answer from master %s (source %s)refreshing stub: unexpected CNAME response from master %s (source %s)refreshing stub: no NS records in response from master %s (source %s)stub->db == ((void *)0)stub->version == ((void *)0)refreshing stub: unable to save NS records from master %s (source %s)stub_callback(((notify) != ((void *)0)) && (((const isc__magic_t *)(notify))->magic == ((('N') << 24 | ('t') << 16 | ('f') << 8 | ('y')))))((*((&(notify->zone)->lock)))++ == 0 ? 0 : 34) == 0(notify->zone)->locked == isc_boolean_false((notify->zone)->locked)(notify->zone->notifies).tail == (notify)(notify->zone->notifies).head == (notify)(--(*((&(notify->zone)->lock))) == 0 ? 0 : 34) == 0task == notify->zone->tasknotify response from %s: %.*snotify to %s failed: %snotify to %s: retries exceedednotify: ignoring IPv6 mapped IPV4 address: %smessagep != ((void *)0) && *messagep == ((void *)0)sending notify to %sdump failed: %szone->notifydelaysending notifies (serial %u)zone_timerdump_donezone_gotwritehandle(&zone->erefs)->refs > 0zone->view == ((void *)0)REQUIRED GLUE SIBLING GLUE %s/NS '%s' has no %saddress records (A or AAAA)%s/NS '%s' is a CNAME (illegal)%s/NS '%s' is below a DNAME '%s' (illegal)%s/MX '%s' has no address records (A or AAAA)%s/MX '%s' is a CNAME (illegal)%s/MX '%s' is below a DNAME '%s' (illegal)%s/SRV '%s' has no address records (A or AAAA)%s/SRV '%s' is a CNAME (illegal)%s/SRV '%s' is below a DNAME '%s' (illegal)saved '%s' as '%s'no master fileloading from master file %s failed: %snumber of nodes in database: %ujournal rollforward failed: %sjournal rollforward failed: journal out of sync with zonejournal rollforward completed successfully: %sloadedcould not find NS and/or SOA recordszone->type == dns_zone_masterixfr-from-differences: new serial (%u) out of range [%u - %u]zone serial has gone backwardszone serial unchanged. zone may fail to transfer to slaves.zone->retryunexpected zone type %dweak %s (%u) key found (exponent=3) (signed)loaded serial %u%sjn-XXXXXXXXdb-XXXXXXXX(((load) != ((void *)0)) && (((const isc__magic_t *)(load))->magic == ((('L') << 24 | ('o') << 16 | ('a') << 8 | ('d')))))((*((&(load->zone)->lock)))++ == 0 ? 0 : 34) == 0(load->zone)->locked == isc_boolean_false((load->zone)->locked)(--(*((&(load->zone)->lock))) == 0 ? 0 : 34) == 0zone->type != dns_zone_noneisc_time_now((&loadtime)) == 0skipping load: master file older than last load_builtinrbt64starting loadloading zone: creating database: %sloading zone: no master file configuredloading zone: no master file configured: continuingargv != ((void *)0) && *argv == ((void *)0).jnlacache != ((void *)0)_toolongzonep != ((void *)0) && *zonep == ((void *)0)event->ev_type == (((4) << 16) + 17)zone_shutdown(zone->zmgr->waiting_for_xfrin).tail == (zone)(zone->zmgr->waiting_for_xfrin).head == (zone)freezingthawing%s zone '%s/%s'%s%s: %szt.c(((zt) != ((void *)0)) && (((const isc__magic_t *)(zt))->magic == ((('Z') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))action != ((void *)0)isc_rwlock_lock((&zt->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&zt->rwlock), (isc_rwlocktype_read)) == 0ztp != ((void *)0) && *ztp == ((void *)0)isc_rwlock_lock((&zt->rwlock), (isc_rwlocktype_write)) == 0zt->references > 0zt->references != 0isc_rwlock_unlock((&zt->rwlock), (isc_rwlocktype_write)) == 0ztp != ((void *)0) && (((*ztp) != ((void *)0)) && (((const isc__magic_t *)(*ztp))->magic == ((('Z') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))+%03d+%05d%sdst_api.cdst_initialized == isc_boolean_true(((dctx) != ((void *)0)) && (((const isc__magic_t *)(dctx))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('C')))))dctx->key->func->adddata != ((void *)0)(((key1) != ((void *)0)) && (((const isc__magic_t *)(key1))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))(((key2) != ((void *)0)) && (((const isc__magic_t *)(key2))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))(((key) != ((void *)0)) && (((const isc__magic_t *)(key))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))key->func->isprivate != ((void *)0)(((pub) != ((void *)0)) && (((const isc__magic_t *)(pub))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K'))))) && (((priv) != ((void *)0)) && (((const isc__magic_t *)(priv))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))sig != ((void *)0)out != ((void *)0).private.keytype == 0x2000000 || type == 0x4000000 || type == 0keyp != ((void *)0) && (((*keyp) != ((void *)0)) && (((const isc__magic_t *)(*keyp))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('K')))))key->func->destroy != ((void *)0)dctxp != ((void *)0) && (((*dctxp) != ((void *)0)) && (((const isc__magic_t *)(*dctxp))->magic == ((('D') << 24 | ('S') << 16 | ('T') << 8 | ('C')))))dctx->key->func->destroyctx != ((void *)0)dctxp != ((void *)0) && *dctxp == ((void *)0)dns_name_isabsolute(name)gssctx != ((void *)0)!dst_key_isprivate(key)dst_initialized%.*s%s(type & (0x2000000 | 0x4000000)) != 0 KEY DNSKEY mctx != ((void *)0) && ectx != ((void *)0)dst_initialized == isc_boolean_falsedst_result.calgorithm is unsupportedopenssl failurebuilt with no crypto supportillegal operation for a null keypublic key is invalidprivate key is invalidUNUSED6error occurred writing key to diskinvalid algorithm specific parameterUNUSED9UNUSED10sign failureUNUSED12UNUSED13verify failurenot a public keynot a private keynot a key that can compute a secretfailure computing a shared secretno randomness availablebad key typehmac_link.cfuncp != ((void *)0)key->keydata.hmacsha512 != ((void *)0)key->keydata.hmacsha384 != ((void *)0)key->keydata.hmacsha256 != ((void *)0)key->keydata.hmacsha224 != ((void *)0)key->keydata.hmacsha1 != ((void *)0)key->keydata.hmacmd5 != ((void *)0)source->length >= 4dst_key_sigsize(key, &maxbits) == 0bits <= maxbitsacache.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('A') << 24 | ('C') << 16 | ('H') << 8 | ('E')))))(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))(((acache) != ((void *)0)) && (((const isc__magic_t *)(acache))->magic == ((('A') << 24 | ('C') << 16 | ('H') << 8 | ('E')))))((*((&acache->lock)))++ == 0 ? 0 : 34) == 0!acache->cevent_sent(--(*((&acache->lock))) == 0 ? 0 : 34) == 0((cleaner)->state == cleaner_s_idle && (cleaner)->resched_event != ((void *)0))cleaner->current_entry == ((void *)0)begin acache cleaning, mem inuse %luevent->ev_type == (((4) << 16) + 40)cleaner->overmem_event == ((void *)0)overmem_cleaning_action called, overmem = %d, state = %d((*((&cleaner->lock)))++ == 0 ? 0 : 34) == 0(--(*((&cleaner->lock))) == 0 ? 0 : 34) == 0lowhighacache memory reaches %s watermark, mem inuse %lu((*((&acache->cleaner.lock)))++ == 0 ? 0 : 34) == 0(--(*((&acache->cleaner.lock))) == 0 ? 0 : 34) == 0could not set acache cleaning interval: %sacache %p cleaning interval set to %d.(((entry) != ((void *)0)) && (((const isc__magic_t *)(entry))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))(entry->foundname->list).tail == (rdataset)(entry->foundname->list).head == (rdataset)entry->db != ((void *)0)dbentryp != ((void *)0) && *dbentryp == ((void *)0)ent->origdb != ((void *)0)(dbent->originlist).tail == (ent)(dbent->originlist).head == (ent)ent->db != ((void *)0)(dbent->referlist).tail == (ent)(dbent->referlist).head == (ent)((*((&acache->entrylocks[entry->locknum])))++ == 0 ? 0 : 34) == 0(--(*((&acache->entrylocks[entry->locknum]))) == 0 ? 0 : 34) == 0((*((&acache->entrylocks[locknum])))++ == 0 ? 0 : 34) == 0entry->foundname != ((void *)0)(--(*((&acache->entrylocks[locknum]))) == 0 ? 0 : 34) == 0(fname->list).tail == (erdataset)(fname->list).head == (erdataset)entryp != ((void *)0) && *entryp == ((void *)0)origdb != ((void *)0)event->ev_type == (((1) << 16) + 1)acache cleaning timer fired, cleaner state = %d(*((&acache->entrylocks[i])) == 0 ? (*((&acache->entrylocks[i])) = -1, 0) : 34) == 0(*((&acache->cleaner.lock)) == 0 ? (*((&acache->cleaner.lock)) = -1, 0) : 34) == 0(*((&acache->lock)) == 0 ? (*((&acache->lock)) = -1, 0) : 34) == 0acachep != ((void *)0) && (((*acachep) != ((void *)0)) && (((const isc__magic_t *)(*acachep))->magic == ((('A') << 24 | ('C') << 16 | ('H') << 8 | ('E')))))(&acache->refs)->refs > 0check_noentry(acache) == isc_boolean_trueentryp != ((void *)0) && (((*entryp) != ((void *)0)) && (((const isc__magic_t *)(*entryp))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))(&entry->references)->refs > 0!((void *)((entry)->link.prev) != (void *)(-1))(dbentry->originlist).tail == (entry)(dbentry->originlist).head == (entry)(acache->entries).tail == (entry)(acache->entries).head == (entry)(dbentry->referlist).tail == (entry)(dbentry->referlist).head == (entry)(((dbentry->originlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false) && (((dbentry->referlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(acache->dbbucket[bucket]).tail == (dbentry)(acache->dbbucket[bucket]).head == (dbentry)((cleaner)->state == cleaner_s_busy && (cleaner)->resched_event == ((void *)0))(((cleaner->current_entry) != ((void *)0)) && (((const isc__magic_t *)(cleaner->current_entry))->magic == ((('A') << 24 | ('C') << 16 | ('E') << 8 | ('T')))))cleaner->current_entry->callback == ((void *)0)(acache->entries).tail == (cleaner->current_entry)(acache->entries).head == (cleaner->current_entry)acache %p stats: hits=%d misses=%d queries=%d adds=%d deleted=%d cleaned=%d cleaner_runs=%d overmem=%d overmem_nocreates=%d nomem=%dend acache cleaning, %lu entries cleaned, mem inuse %luacache is still in overmem state after cleaningtask == acache->taskevent->ev_type == (((4) << 16) + 39)now32 > last32entry != ((void *)0)acache cleaner: still overmem, reset and try againnext != ((void *)0) && next != cleaner->current_entryacache cleaner: checked %d entries, mem inuse %lu, sleepingacache->shutting_down(((dbent->originlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false) && (((dbent->referlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(acache->dbbucket[i]).tail == (dbent)(acache->dbbucket[i]).head == (dbent)acache->dbentries == 0acachep != ((void *)0) && *acachep == ((void *)0)taskmgr != ((void *)0)isc_task_create() failed(): %sacachetaskacache cleaner: isc_task_onshutdown() failed: %sisc_timer_create() failed: %s(*((&cleaner->lock)) == 0 ? (*((&cleaner->lock)) = -1, 0) : 34) == 0(&acache->refs)->refs == 0event->ev_type == (((0) << 16) + 1)acache->live_cleaners == 0acl.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('a') << 16 | ('c') << 8 | ('l')))))(&source->refcount)->refs > 0((*((&insecure_prefix_lock)))++ == 0 ? 0 : 34) == 0(--(*((&insecure_prefix_lock))) == 0 ? 0 : 34) == 0(((acl) != ((void *)0)) && (((const isc__magic_t *)(acl))->magic == ((('D') << 24 | ('a') << 16 | ('c') << 8 | ('l')))))(&acl->refcount)->refs > 0(&dacl->refcount)->refs == 0reqaddr != ((void *)0)matchelt == ((void *)0) || *matchelt == ((void *)0)adb.cbucket != (-1)(adb->names[bucket]).tail == (name)(adb->names[bucket]).head == (name)adb->name_refcnt[bucket] > 0(adb->entries[bucket]).tail == (entry)(adb->entries[bucket]).head == (entry)adb->entry_refcnt[bucket] > 0(((adb) != ((void *)0)) && (((const isc__magic_t *)(adb))->magic == ((('D') << 24 | ('a') << 16 | ('d') << 8 | ('b')))))(((addr) != ((void *)0)) && (((const isc__magic_t *)(addr))->magic == ((('a') << 24 | ('d') << 16 | ('A') << 8 | ('I')))))((*((&adb->entrylocks[bucket])))++ == 0 ? 0 : 34) == 0(--(*((&adb->entrylocks[bucket]))) == 0 ? 0 : 34) == 0adbx != ((void *)0) && *adbx == ((void *)0)((*((&adb->reflock)))++ == 0 ? 0 : 34) == 0(--(*((&adb->reflock))) == 0 ? 0 : 34) == 0(((find) != ((void *)0)) && (((const isc__magic_t *)(find))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('H')))))((*((&find->lock)))++ == 0 ? 0 : 34) == 0(--(*((&find->lock))) == 0 ? 0 : 34) == 0adb reached %s water mark((*((&adb->overmemlock)))++ == 0 ? 0 : 34) == 0(--(*((&adb->overmemlock))) == 0 ? 0 : 34) == 0dns_adb_cancelfind on find %p!(((find)->flags & 0x80000000) != 0)(((find)->options & 0x00000008) != 0)(--(*((have))) == 0 ? 0 : 34) == 0((*((want)))++ == 0 ? 0 : 34) == 0((*((have)))++ == 0 ? 0 : 34) == 0(find->adbname->finds).tail == (find)(find->adbname->finds).head == (find)(--(*((&adb->namelocks[unlock_bucket]))) == 0 ? 0 : 34) == 0sending event %p to task %p for find %padb->irefcnt > 0(adb->whenshutdown).tail == (event)(adb->whenshutdown).head == (event)ENTER clean_finds_at_name, name %p, evtype %08x, addrs %08xDNS_EVENT_ADBMOREADDRESSESDNS_EVENT_ADBNOMOREADDRESSEScfan: processing find %p(name->finds).tail == (find)(name->finds).head == (find)!(((find)->flags & 0x40000000) != 0)EXIT clean_finds_at_name, name %pcfan: skipping find %painfo != ((void *)0) && (((*ainfo) != ((void *)0)) && (((const isc__magic_t *)(*ainfo))->magic == ((('a') << 24 | ('d') << 16 | ('A') << 8 | ('I')))))ai->entry == ((void *)0)!((void *)((ai)->publink.prev) != (void *)(-1))findp != ((void *)0) && (((*findp) != ((void *)0)) && (((const isc__magic_t *)(*findp))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('H')))))!(!((((find)->list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false))!((void *)((find)->publink.prev) != (void *)(-1))!((void *)((find)->plink.prev) != (void *)(-1))find->name_bucket == (-1)find->adbname == ((void *)0)(*((&find->lock)) == 0 ? (*((&find->lock)) = -1, 0) : 34) == 0namehook != ((void *)0) && (((*namehook) != ((void *)0)) && (((const isc__magic_t *)(*namehook))->magic == ((('a') << 24 | ('d') << 16 | ('N') << 8 | ('H')))))nh->entry == ((void *)0)!((void *)((nh)->plink.prev) != (void *)(-1))lameinfo != ((void *)0) && (((*lameinfo) != ((void *)0)) && (((const isc__magic_t *)(*lameinfo))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('Z')))))!((void *)((li)->plink.prev) != (void *)(-1))(entry->lameinfo).tail == (li)(entry->lameinfo).head == (li)entry != ((void *)0) && (((*entry) != ((void *)0)) && (((const isc__magic_t *)(*entry))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('E')))))e->lock_bucket == (-1)e->refcnt == 0!((void *)((e)->plink.prev) != (void *)(-1))(e->lameinfo).tail == (li)(e->lameinfo).head == (li)cleaning entry bucket %dresult == isc_boolean_falseentryp != ((void *)0) && (((*entryp) != ((void *)0)) && (((const isc__magic_t *)(*entryp))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('E')))))killing entry %p((void *)((entry)->plink.prev) != (void *)(-1))entry->refcnt > 0(((namehook) != ((void *)0)) && (((const isc__magic_t *)(namehook))->magic == ((('a') << 24 | ('d') << 16 | ('N') << 8 | ('H')))))(((entry) != ((void *)0)) && (((const isc__magic_t *)(entry))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('E')))))(--(*((&adb->entrylocks[addr_bucket]))) == 0 ? 0 : 34) == 0((*((&adb->entrylocks[addr_bucket])))++ == 0 ? 0 : 34) == 0(*namehooks).tail == (namehook)(*namehooks).head == (namehook)name != ((void *)0) && (((*name) != ((void *)0)) && (((const isc__magic_t *)(*name))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))!(!((((n)->v4).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false))!(!((((n)->v6).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false))!((((n)->fetch_a != ((void *)0))) || (((n)->fetch_aaaa != ((void *)0))))(((n->finds).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)!((void *)((n)->plink.prev) != (void *)(-1))n->lock_bucket == (-1)n->adb == adb(((name) != ((void *)0)) && (((const isc__magic_t *)(name))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))expiring v4 for name %pexpiring v6 for name %pkilling name %p((*((&adb->lock)))++ == 0 ? 0 : 34) == 0((*((&adb->namelocks[bucket])))++ == 0 ? 0 : 34) == 0kill_name(&adbname, (((4) << 16) + 10), isc_boolean_true) == isc_boolean_false(--(*((&adb->namelocks[bucket]))) == 0 ? 0 : 34) == 0(--(*((&adb->lock))) == 0 ? 0 : 34) == 0namep != ((void *)0) && (((*namep) != ((void *)0)) && (((const isc__magic_t *)(*namep))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))cleaning name bucket %dcleanup_names(adb, i, 2147483647) == isc_boolean_falsecleanup_entries(adb, i, 2147483647) == isc_boolean_falsefactor <= 10!adb->cevent_sentaddrp != ((void *)0)dns_adb_destroyfind on find %p(((find)->flags & 0x80000000) != 0)(find->list).tail == (ai)(find->list).head == (ai)dec_entry_refcnt(adb, entry, isc_boolean_true) == isc_boolean_falseadbx != ((void *)0) && (((*adbx) != ((void *)0)) && (((const isc__magic_t *)(*adbx))->magic == ((('D') << 24 | ('a') << 16 | ('d') << 8 | ('b')))))adb->erefcnt > 0adb->shutting_down(--(*((&adb->entrylocks[*bucketp]))) == 0 ? 0 : 34) == 0addrp != ((void *)0) && *addrp == ((void *)0)findaddrinfo: new entry %pfindaddrinfo: found entry %pqname != ((void *)0) Fetch(%s): %p -> { nh %p, entry %p, fetch %p } [%s TTL %d];Find %p ; qpending %08x partial %08x options %08x flags %08x ; name_bucket %d, name %p, event sender %p Addresses: UnkFamilyBadAddress entry %p, flags %08x srtt %u addr %s ; %p: refcnt %u ; %s [srtt %u] [flags %08x] [ttl %d]; %s [lame TTL %d] ; Hook(%s) %p cleanup_names(adb, i, now) == isc_boolean_falsecleanup_entries(adb, i, now) == isc_boolean_false; ; Address database dump ; ((*((&adb->namelocks[i])))++ == 0 ? 0 : 34) == 0((*((&adb->entrylocks[i])))++ == 0 ? 0 : 34) == 0; alias v4v6target [v4 %s] [v6 %s]; ; Unassociated entries ; (--(*((&adb->entrylocks[i]))) == 0 ? 0 : 34) == 0(--(*((&adb->namelocks[i]))) == 0 ? 0 : 34) == 0fetch != ((void *)0) && (((*fetch) != ((void *)0)) && (((const isc__magic_t *)(*fetch))->magic == ((('a') << 24 | ('d') << 16 | ('F') << 8 | ('4')))))(((adbname) != ((void *)0)) && (((const isc__magic_t *)(adbname))->magic == ((('a') << 24 | ('d') << 16 | ('b') << 8 | ('N')))))(rdtype == ((dns_rdatatype_t)dns_rdatatype_a)) || (rdtype == ((dns_rdatatype_t)dns_rdatatype_aaaa))rdata.length == 4rdata.length == 16nh == ((void *)0)expire_v4 set to MIN(%u,%u) import_rdatasetexpire_v6 set to MIN(%u,%u) import_rdatasetdns_name_countlabels(target) == 0rdtype == ((dns_rdatatype_t)dns_rdatatype_a) || rdtype == ((dns_rdatatype_t)dns_rdatatype_aaaa)adb name %p: Caching auth negative entry for Aadb name %p: Caching auth negative entry for AAAAadb name %p: Caching negative entry for A (ttl %u)adb name %p: Caching negative entry for AAAA (ttl %u)adb name %p: caching alias target(type == ((dns_rdatatype_t)dns_rdatatype_a) && !(((adbname)->fetch_a != ((void *)0)))) || (type == ((dns_rdatatype_t)dns_rdatatype_aaaa) && !(((adbname)->fetch_aaaa != ((void *)0))))fetch_name: starting at zone for name %pfindp != ((void *)0) && *findp == ((void *)0)target == ((void *)0) || dns_name_hasbuffer(target)(options & 0x00000003) != 0dns_adb_createfind: returning ISC_R_SHUTTINGDOWNfree_adbfind(adb, &find) == isc_boolean_falsekill_name(&victim, (((4) << 16) + 10), isc_boolean_true) == isc_boolean_falsename->lock_bucket == (-1)(adb->names[bucket]).tail == (adbname)(adb->names[bucket]).head == (adbname)check_expire_namehooks(adbname, now) == isc_boolean_falsedns_adb_createfind: name %p is an alias (cached)dns_adb_createfind: found A for name %p in dbdns_adb_createfind: name %p is an aliasdns_adb_createfind: found AAAA for name %pdns_adb_createfind: started A fetch for name %pdns_adb_createfind: started AAAA fetch for name %pcreatefind: attaching find %p to adbname %p(find->flags & 0x00000003) != 0timermgr != ((void *)0)newadb != ((void *)0) && *newadb == ((void *)0)adbnameadbnamehookadblameinfoadbentryadbfindadbaddrinfoadbfetchisc_mutexblock_destroy((adb->entrylocks), (1009)) == 0isc_mutexblock_destroy((adb->namelocks), (1009)) == 0(*((&adb->overmemlock)) == 0 ? (*((&adb->overmemlock)) = -1, 0) : 34) == 0(*((&adb->reflock)) == 0 ? (*((&adb->reflock)) = -1, 0) : 34) == 0(*((&adb->mplock)) == 0 ? (*((&adb->mplock)) = -1, 0) : 34) == 0(*((&adb->lock)) == 0 ? (*((&adb->lock)) = -1, 0) : 34) == 0ev->ev_type == (((4) << 16) + 1)((name)->fetch_a != ((void *)0)) || ((name)->fetch_aaaa != ((void *)0))adb fetch name %p: caching negative entry for A (ttl %u)adb fetch name %p: caching negative entry for AAAA (ttl %u)adb fetch name %p: caching alias targetadb: fetch of '%s' %s failed: %saddress_type != 0canceledunexpectednot_found"@X,3dpcache.c(((cache) != ((void *)0)) && (((const isc__magic_t *)(cache))->magic == ((('$') << 24 | ('$') << 16 | ('$') << 8 | ('$')))))((*((&cache->lock)))++ == 0 ? 0 : 34) == 0(--(*((&cache->lock))) == 0 ? 0 : 34) == 0cache->db != ((void *)0)((*((&cache->cleaner.lock)))++ == 0 ? 0 : 34) == 0(--(*((&cache->cleaner.lock))) == 0 ? 0 : 34) == 0cache cleaner: dns_db_expirenode() failed: %scould not set cache cleaning interval: %s((*((&cache->filelock)))++ == 0 ? 0 : 34) == 0(--(*((&cache->filelock))) == 0 ? 0 : 34) == 0cache->references == 0(*((&cache->cleaner.lock)) == 0 ? (*((&cache->cleaner.lock)) = -1, 0) : 34) == 0(*((&cache->lock)) == 0 ? (*((&cache->lock)) = -1, 0) : 34) == 0(*((&cache->filelock)) == 0 ? (*((&cache->filelock)) = -1, 0) : 34) == 0cachep != ((void *)0)cache->references > 0error dumping cache: %s isc_task_create() failed: %scachecleanercache cleaner: isc_task_onshutdown() failed: %s*cachep == ((void *)0)((cleaner)->state == cleaner_s_busy && (cleaner)->iterator != ((void *)0) && (cleaner)->resched_event == ((void *)0))end cache cleaning, mem inuse %lucache cleaner could not create iterator: %scache cleaner: dns_dbiterator_first() failed: %sbegin cache cleaning, mem inuse %lutask == cleaner->taskevent->ev_type == (((4) << 16) + 27)cache cleaning timer fired, cleaner state = %devent->ev_type == (((4) << 16) + 15)((*((&cleaner->cache->lock)))++ == 0 ? 0 : 34) == 0(--(*((&cleaner->cache->lock))) == 0 ? 0 : 34) == 0(((cleaner->iterator) != ((void *)0)) && (((const isc__magic_t *)(cleaner->iterator))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('I')))))cache cleaner: dns_dbiterator_current() failed: %scache cleaner: dns_dbiterator_next() failed: %scache cleaner: still overmem, reset and try againcache cleaner: checked %u nodes, mem inuse %lu, sleepingtask == cache->cleaner.taskcache->live_tasks == 0callbacks.ccallbacks != ((void *)0)db.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))*targetp == sourcedbp != ((void *)0)(((*dbp) != ((void *)0)) && (((const isc__magic_t *)(*dbp))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))*dbp == ((void *)0)(((db) != ((void *)0)) && (((const isc__magic_t *)(db))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('D')))))(db->attributes & 0x01) == 0addp != ((void *)0) && *addp == ((void *)0)dbloadp != ((void *)0) && *dbloadp == ((void *)0)dbloadp != ((void *)0) && *dbloadp != ((void *)0)*targetp != ((void *)0)versionp != ((void *)0) && *versionp != ((void *)0)*versionp == ((void *)0)nodep != ((void *)0) && *nodep != ((void *)0)sourcep != ((void *)0) && *sourcep != ((void *)0)*sourcep == ((void *)0)(db->attributes & 0x01) != 0iteratorp != ((void *)0) && *iteratorp == ((void *)0)((db->attributes & 0x01) == 0 && version != ((void *)0))|| ((db->attributes & 0x01) != 0 && version == ((void *)0))dns_db_iszone(db) == isc_boolean_trueisc_rwlock_init(&implock, 0, 0) == 0dbimp != ((void *)0) && *dbimp != ((void *)0)isc_rwlock_lock((&implock), (isc_rwlocktype_write)) == 0(implementations).tail == (imp)(implementations).head == (imp)isc_rwlock_unlock((&implock), (isc_rwlocktype_write)) == 0dbimp != ((void *)0) && *dbimp == ((void *)0)(db->attributes & 0x01) == 0 && version != ((void *)0)dns_rdataset_isassociated(rdataset)rdataset->rdclass == db->rdclassnewrdataset == ((void *)0) || ((((newrdataset) != ((void *)0)) && (((const isc__magic_t *)(newrdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(newrdataset))((db->attributes & 0x01) == 0 && version != ((void *)0))|| ((db->attributes & 0x01) != 0 && version == ((void *)0) && (options & 0x01) == 0)(options & 0x04) == 0 || (options & 0x01) != 0addedrdataset == ((void *)0) || ((((addedrdataset) != ((void *)0)) && (((const isc__magic_t *)(addedrdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(addedrdataset))covers == 0 || type == ((dns_rdatatype_t)dns_rdatatype_rrsig)type != ((dns_rdatatype_t)dns_rdatatype_any)sigrdataset == ((void *)0) || ((((sigrdataset) != ((void *)0)) && (((const isc__magic_t *)(sigrdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(sigrdataset))dns_db_iszone(db) || dns_db_isstub(db)rdata.length > 20nodep == ((void *)0) || (nodep != ((void *)0) && *nodep == ((void *)0))dns_name_hasbuffer(foundname)rdataset == ((void *)0) || ((((rdataset) != ((void *)0)) && (((const isc__magic_t *)(rdataset))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('R'))))) && ! dns_rdataset_isassociated(rdataset))dns_name_isabsolute(origin)isc_rwlock_lock((&implock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&implock), (isc_rwlocktype_read)) == 0unsupported database type '%s'dbiterator.c(((*iteratorp) != ((void *)0)) && (((const isc__magic_t *)(*iteratorp))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('I')))))(((iterator) != ((void *)0)) && (((const isc__magic_t *)(iterator))->magic == ((('D') << 24 | ('N') << 16 | ('S') << 8 | ('I')))))iterator->relative_namesdns_name_hasbuffer(name)name == ((void *)0) || dns_name_hasbuffer(name)dispatch.c((((mgr)) != ((void *)0)) && (((const isc__magic_t *)((mgr)))->magic == ((('D') << 24 | ('M') << 16 | ('g') << 8 | ('r')))))((((disp)) != ((void *)0)) && (((const isc__magic_t *)((disp)))->magic == ((('D') << 24 | ('i') << 16 | ('s') << 8 | ('p')))))dispp != ((void *)0) && *dispp == ((void *)0)((*((&disp->lock)))++ == 0 ? 0 : 34) == 0(--(*((&disp->lock))) == 0 ? 0 : 34) == 0((*((&disp->mgr->buffer_lock)))++ == 0 ? 0 : 34) == 0(--(*((&disp->mgr->buffer_lock))) == 0 ? 0 : 34) == 0(disp->attributes & 0x00000020U) != 0sevent->n <= disp->mgr->buffersizeret < qid->qid_nbucketsbucket < qid->qid_nbucketsdispatch %p: %sdispatchmgr %p: %sqidp != ((void *)0)((((qid)) != ((void *)0)) && (((const isc__magic_t *)((qid)))->magic == ((('Q') << 24 | ('i') << 16 | ('d') << 8 | (' ')))))(*((&qid->lock)) == 0 ? (*((&qid->lock)) = -1, 0) : 34) == 0disp->shutdown_out == 1buf != ((void *)0) && len != 0disp->tcpbuffers > 0disp->mgr->buffers > 0len == disp->mgr->buffersizedispatch %p response %p %s: %sdispatch %p req/resp %p: %s((*((&qid->lock)))++ == 0 ? 0 : 34) == 0cancel: failsafe event %p -> task %p(--(*((&qid->lock))) == 0 ? 0 : 34) == 0disp->recv_pending == 0starttcp %pgot packet: requests %d, buffers %d, recvs %ddisp->recv_pending != 0odd socket result in udp_recv(): %sblackholed packet from %sgot garbage packetgot valid DNS message header, /QR %c, id %usearch for response in bucket %d: %s[a] Sent event %p buffer %p len %d to task %pgot TCP packet: requests %d, buffers %d, recvs %dshutting down on EOFshutting down due to TCP receive error: %s: %sresult %d, length == %d, addr = %p[b] Sent event %p buffer %p len %d to task %pdispp != ((void *)0) && ((((*dispp)) != ((void *)0)) && (((const isc__magic_t *)((*dispp)))->magic == ((('D') << 24 | ('i') << 16 | ('s') << 8 | ('p')))))disp->refcount > 0detach: refcount %d((((*resp)) != ((void *)0)) && (((const isc__magic_t *)((*resp)))->magic == ((('D') << 24 | ('r') << 16 | ('s') << 8 | ('p')))))*sockevent != ((void *)0)disp->requests > 0(qid->qid_table[bucket]).tail == (res)(qid->qid_table[bucket]).head == (res)res->item_out == isc_boolean_truedetaching from task %p(res->items).tail == (ev)(res->items).head == (ev)((*((&mgr->arc4_lock)))++ == 0 ? 0 : 34) == 0(--(*((&mgr->arc4_lock))) == 0 ? 0 : 34) == 0dest != ((void *)0)idp != ((void *)0)attached to task %pbuckets < 2097169increment > bucketsqidp != ((void *)0) && *qidp == ((void *)0)sock != ((void *)0) || sockaddrp != ((void *)0)(*((&disp->lock)) == 0 ? (*((&disp->lock)) = -1, 0) : 34) == 0dispatcherdisp->tcpbuffers == 0disp->requests == 0sockmgr != ((void *)0)localaddr != ((void *)0)buffersize >= 512 && buffersize < (64 * 1024)maxbuffers > 0(attributes & 0x00000002U) == 0((*((&mgr->buffer_lock)))++ == 0 ? 0 : 34) == 0(--(*((&mgr->buffer_lock))) == 0 ? 0 : 34) == 0dispmgr_bpool((*((&mgr->lock)))++ == 0 ? 0 : 34) == 0isc_sockaddr_getport(localaddr) == 0(--(*((&mgr->lock))) == 0 ? 0 : 34) == 0avoid-v%s-udp-ports: unable to allocate a non-blacklisted portudpdispatchcreated UDP dispatcher %pcreated task %pcreated socket %pdestroy_mgr_ok: shuttingdown=%d, listnonempty=%d, epool=%d, rpool=%d, dpool=%d(*((&mgr->lock)) == 0 ? (*((&mgr->lock)) = -1, 0) : 34) == 0(*((&mgr->arc4_lock)) == 0 ? (*((&mgr->arc4_lock)) = -1, 0) : 34) == 0(*((&mgr->pool_lock)) == 0 ? (*((&mgr->pool_lock)) = -1, 0) : 34) == 0(*((&mgr->buffer_lock)) == 0 ? (*((&mgr->buffer_lock)) = -1, 0) : 34) == 0mgrp != ((void *)0)((((*mgrp)) != ((void *)0)) && (((const isc__magic_t *)((*mgrp)))->magic == ((('D') << 24 | ('M') << 16 | ('g') << 8 | ('r')))))destroy: killit=%devent->ev_type == (((4) << 16) + 32)(mgr->list).tail == (disp)(mgr->list).head == (disp)shutting down; detaching from sock %p, task %pisc_socket_gettype(sock) == isc_sockettype_tcp(attributes & 0x00000002U) != 0(attributes & 0x00000004U) == 0tcpdispatchcreated TCP dispatcher %p(((mgr->list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)mgr->stats == ((void *)0)mgrp != ((void *)0) && *mgrp == ((void *)0)dispmgr_epooldispmgr_rpooldispmgr_dpooldlz.c(((view->dlzdatabase) != ((void *)0)) && (((const isc__magic_t *)(view->dlzdatabase))->magic == ((('D') << 24 | ('L') << 16 | ('Z') << 8 | ('D')))))Unloading DLZ driver.dbp != ((void *)0) && (((*dbp) != ((void *)0)) && (((const isc__magic_t *)(*dbp))->magic == ((('D') << 24 | ('L') << 16 | ('Z') << 8 | ('D')))))isc_rwlock_init(&dlz_implock, 0, 0) == 0Unregistering DLZ driver.dlzimp != ((void *)0) && *dlzimp != ((void *)0)isc_rwlock_lock((&dlz_implock), (isc_rwlocktype_write)) == 0(dlz_implementations).tail == (dlz_imp)(dlz_implementations).head == (dlz_imp)isc_rwlock_unlock((&dlz_implock), (isc_rwlocktype_write)) == 0Registering DLZ driver '%s'drivername != ((void *)0)methods->create != ((void *)0)methods->destroy != ((void *)0)methods->findzone != ((void *)0)dlzimp != ((void *)0) && *dlzimp == ((void *)0)DLZ Driver '%s' already registereddlzname != ((void *)0)Loading '%s' using driver %sisc_rwlock_lock((&dlz_implock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&dlz_implock), (isc_rwlocktype_read)) == 0unsupported DLZ database driver '%s'. %s not loaded.DLZ driver loaded successfully.DLZ driver failed to load.dnssec.cmsg->query.base != ((void *)0)r.length >= 19dns_name_downcase(&sig->signer, (&((&fname)->name)), ((void *)0)) == 0sigrdata != ((void *)0) && sigrdata->type == ((dns_rdatatype_t)dns_rdatatype_rrsig)dns_name_downcase(name, (&((&fnewname)->name)), ((void *)0)) == 0rdatas[i].length < 65536dns_name_concatenate(dns_wildcardname, (&((&fnewname)->name)), wild, ((void *)0)) == 0dns_name_countlabels(name) <= 255inception != ((void *)0)expire != ((void *)0)sigrdata != ((void *)0)*key == ((void *)0)rdata->type == ((dns_rdatatype_t)dns_rdatatype_key) || rdata->type == ((dns_rdatatype_t)dns_rdatatype_dnskey)nkeys != ((void *)0)keys != ((void *)0)ds.ckey->type == ((dns_rdatatype_t)dns_rdatatype_dnskey)r.length >= 4forward.c(forwarders->addrs).tail == (sa)(forwarders->addrs).head == (sa)fwdtablep != ((void *)0) && (((*fwdtablep) != ((void *)0)) && (((const isc__magic_t *)(*fwdtablep))->magic == ((('F') << 24 | ('w') << 16 | ('d') << 8 | ('T')))))(((fwdtable) != ((void *)0)) && (((const isc__magic_t *)(fwdtable))->magic == ((('F') << 24 | ('w') << 16 | ('d') << 8 | ('T')))))isc_rwlock_lock((&fwdtable->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&fwdtable->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_lock((&fwdtable->rwlock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&fwdtable->rwlock), (isc_rwlocktype_write)) == 0fwdtablep != ((void *)0) && *fwdtablep == ((void *)0)iptable.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('T') << 24 | ('a') << 16 | ('b') << 8 | ('l')))))(((tab) != ((void *)0)) && (((const isc__magic_t *)(tab))->magic == ((('T') << 24 | ('a') << 16 | ('b') << 8 | ('l')))))(&tab->refcount)->refs > 0(((dtab) != ((void *)0)) && (((const isc__magic_t *)(dtab))->magic == ((('T') << 24 | ('a') << 16 | ('b') << 8 | ('l')))))(&dtab->refcount)->refs == 0tab->radixjournal.ci < j->header.index_size! ((j->index[i]).offset != 0)j->it.result == 0%s: write: %s%s: read: %s%s: seek: %sp == j->rawindex + rawbytes(((j) != ((void *)0)) && (((const isc__magic_t *)(j))->magic == ((('J') << 24 | ('O') << 16 | ('U') << 8 | ('R')))))j->state == JOURNAL_STATE_WRITE%s: journal file corrupt: expected serial %u, got %u%s: offset too largej->it.bpos.serial == begin_serialj->it.epos.serial == end_serialjournalp != ((void *)0) && *journalp == ((void *)0)rbrb+journal file %s does not exist, creating itwb%s: create: %s%s: close: %s%s: open: %s%s: journal format not recognized%.*s.jbk%s: flush: %s%s: fsync: %sj->state == JOURNAL_STATE_TRANSACTION%s: malformed transaction: %d SOAs%s: malformed transaction: serial number would decreasemalformed transaction: %s last serial %u != transaction first serial %uj->offset <= j->it.epos.offset%s: journal corrupt: empty transaction%s: journal corrupt: impossible RR size (%d bytes)%.*s.jnwbest_guess.serial != j->header.end.serialno journal file, but that's OK%s: journal file corrupt: missing initial SOA%s: applying diff to database (%u)%s: applying final diff to database (%u)(((diff) != ((void *)0)) && (((const isc__magic_t *)(diff))->magic == ((('D') << 24 | ('I') << 16 | ('F') << 8 | ('F')))))writing to journalt->rdata.length < 65536((&buffer)->length - (&buffer)->used) >= t->rdata.lengthused.length == size(((diff[0].tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((diff[1].tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((diff[i].tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(diff[i].tuples).tail == (p[i])(diff[i].tuples).head == (p[i])(diff[0].tuples).tail == (p[0])(diff[0].tuples).head == (p[0])(diff[1].tuples).tail == (p[1])(diff[1].tuples).head == (p[1])no changesmissing SOAno journal filejournal open failure: %s: %s%s: cannot print: journal file corruptkeytable.c(((keynode) != ((void *)0)) && (((const isc__magic_t *)(keynode))->magic == ((('K') << 24 | ('N') << 16 | ('o') << 8 | ('d')))))(((keytable) != ((void *)0)) && (((const isc__magic_t *)(keytable))->magic == ((('K') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))keynodep != ((void *)0) && (((*keynodep) != ((void *)0)) && (((const isc__magic_t *)(*keynodep))->magic == ((('K') << 24 | ('N') << 16 | ('o') << 8 | ('d')))))((*((&keytable->lock)))++ == 0 ? 0 : 34) == 0keytable->active_nodes > 0(--(*((&keytable->lock))) == 0 ? 0 : 34) == 0wantdnssecp != ((void *)0)isc_rwlock_lock((&keytable->rwlock), (isc_rwlocktype_read)) == 0isc_rwlock_unlock((&keytable->rwlock), (isc_rwlocktype_read)) == 0foundname != ((void *)0)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('K') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))nextnodep != ((void *)0) && *nextnodep == ((void *)0)keynodep != ((void *)0) && *keynodep == ((void *)0)isc_rwlock_lock((&keytable->rwlock), (isc_rwlocktype_write)) == 0isc_rwlock_unlock((&keytable->rwlock), (isc_rwlocktype_write)) == 0keytablep != ((void *)0) && (((*keytablep) != ((void *)0)) && (((const isc__magic_t *)(*keytablep))->magic == ((('K') << 24 | ('T') << 16 | ('b') << 8 | ('l')))))keytable->references > 0(*((&keytable->lock)) == 0 ? (*((&keytable->lock)) = -1, 0) : 34) == 0keytablep != ((void *)0) && *keytablep == ((void *)0)libdns.catlog.clctx != ((void *)0)notifysecurity_placeholderxfer-inxfer-outlame-serversdelegation-onlyedns-disableddns/dbdns/rbtdbdns/rbtdb64dns/rbtdns/rdatadns/masterdns/messagedns/cachedns/configdns/resolverdns/zonedns/journaldns/adbdns/xfrindns/xfroutdns/acldns/validatordns/dispatchdns/requestdns/masterdumpdns/tsigdns/tkeydns/sdbdns/diffdns/hintsdns/acachedns/dlz%s: %s:%lu: $TTL %lu > MAXTTL, setting $TTL to 0dns_master_loadmaster.c(((lctx) != ((void *)0)) && (((const isc__magic_t *)(lctx))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))((*((&lctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&lctx->lock))) == 0 ? 0 : 34) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))(this->rdata).tail == (rdata)(this->rdata).head == (rdata)(save).tail == (rdata)rdcount == old_lenmaster_file != ((void *)0)new_in_use < 4lctxp != ((void *)0) && *lctxp == ((void *)0)callbacks->add != ((void *)0)dns_name_isabsolute(top)(task == ((void *)0) && done == ((void *)0)) || (task != ((void *)0) && done != ((void *)0))((buffer)->length - (buffer)->used) >= lendns_rdatalist_tordataset(this, &dataset) == 0dns_master_load: %s%s: %s:%lu: %s: %s%s: %s: %s(*head).tail == (this)(*head).head == (this)isc_stdio_read failed: %sdns_master_load: file format mismatchdns_master_load: unsupported file format version((&target)->length - (&target)->used) >= sizeof(totallen)((&target)->current) <= readleni > 0(rdatalist.rdata).tail == (&rdata[j])(rdatalist.rdata).head == (&rdata[j])(rdatalist.rdata).tail == (&rdata[i])(rdatalist.rdata).head == (&rdata[i])lctx->done != ((void *)0) && lctx->task != ((void *)0)isc_stdio_open() failed: %s{%d,%u,%1[doxX]}%%0%ud%%0%u%cdns_master_load: %s:%lu: isc_lex_gettoken() failed: %slinedns_master_load: %s:%lu: unexpected end of %s%s: file does not end with newlineisc_lex_close(lctx->lex) == 0$ORIGIN$TTL$INCLUDE%s: %s:%lu: $INCLUDE not allowed%s: %s:%lu: $INCLUDE may not be used with $DATE$DATE%s: %s:%lu: $DATE outside epoch%s: %s:%lu: $DATE in future, using current date$GENERATE%s: %s:%lu: no TTL specified%u-%u/%u%s: %s:%lu: invalid range '%s'%s: %s:%lu: unknown RR type '%s'%s: %s:%lu: unsupported type '%s'%s:%lu: ignoring out-of-zone data (%s)(rdatalist.rdata).tail == (&rdata)(rdatalist.rdata).head == (&rdata)$GENERATE: %s$GENERATE: %s:%lu: %s$%s: %s:%lu: unknown $ directive '%s'%s:%lu: warning: ownername '%s' contains an non-terminal wildcard%s:%lu: isc_lex_gettoken() returned unexpected token type (%d)%s:%lu: no current owner nameisc_lex_gettoken() returned unexpected token type%s:%lu: unknown RR type '%.*s'%s:%lu: class '%s' != zone class '%s'%s:%lu: %s '%s': %s%s:%lu: SOA record not at top of zone (%s)%s:%lu: no TTL specified; using SOA MINTTL instead%s:%lu: no TTL specified; zone rejected%s:%lu: using RFC1035 TTL semantics%s:%lu: signature has expired%s:%lu: old style DNSSEC zone detected(*current).tail == (this)(*current).head == (this)(save).tail == (this)(*glue).tail == (this)(*glue).head == (this)rdlcount == old_len%s:%lu: TTL set to prior TTL (%lu)(current_list).tail == (this)(current_list).head == (this)(glue_list).tail == (this)(glue_list).head == (this)%s:%lu: NS record '%s' appears to be an addresslctxp != ((void *)0)lctx->references > 0isc_stdio_close() failed: %s(*((&lctx->lock)) == 0 ? (*((&lctx->lock)) = -1, 0) : 34) == 0lex != ((void *)0)stream != ((void *)0)nSND44nSND4 4nSND4 5ncache.cncacherdataset != ((void *)0)ncacherdataset->type == 0dns_rdataset_next(ncacherdataset) == 29remaining.length >= tname.lengthremaining.length >= 4remaining.length >= 2remaining.length >= lengthraw != ((void *)0)rdataset->type == 0dns_rdataset_next(rdataset) == 29remaining.length >= name.lengthremaining.length >= rdata.lengthmessage != ((void *)0)count <= 65535r.length <= 65535dns_rdatalist_tordataset(&ncrdatalist, &ncrdataset) == 0nsec.cnsec != ((void *)0)nsec->type == ((dns_rdatatype_t)dns_rdatatype_nsec)i + 2 <= nsecstruct.leni + len <= nsecstruct.lenr.length <= (255 + 8192 + 512)order.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('O') << 24 | ('r') << 16 | ('d') << 8 | ('r')))))(((order) != ((void *)0)) && (((const isc__magic_t *)(order))->magic == ((('O') << 24 | ('r') << 16 | ('d') << 8 | ('r')))))(&order->references)->refs > 0(order->ents).tail == (ent)(order->ents).head == (ent)(&order->references)->refs == 0mode == 0x00000800 || mode == 0x00000400 || mode == 0dns_name_copy(name, (&((&ent->name)->name)), ((void *)0)) == 0orderp != ((void *)0) && *orderp == ((void *)0)peer.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('s') << 24 | ('e') << 16 | ('R') << 8 | ('L')))))*target == ((void *)0)source->refs != 0xffffffffU(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('S') << 24 | ('E') << 16 | ('r') << 8 | ('v')))))(((peer) != ((void *)0)) && (((const isc__magic_t *)(peer))->magic == ((('S') << 24 | ('E') << 16 | ('r') << 8 | ('v')))))retval != ((void *)0)transfer_source != ((void *)0)notify_source != ((void *)0)query_source != ((void *)0)udpsize != ((void *)0)maxudp != ((void *)0)peer != ((void *)0)*peer != ((void *)0)(((*peer) != ((void *)0)) && (((const isc__magic_t *)(*peer))->magic == ((('S') << 24 | ('E') << 16 | ('r') << 8 | ('v')))))p->refs > 0p->refs == 0*list != ((void *)0)(((*list) != ((void *)0)) && (((const isc__magic_t *)(*list))->magic == ((('s') << 24 | ('e') << 16 | ('R') << 8 | ('L')))))plist->refs > 0l->refs == 0(l->elements).tail == (server)(l->elements).head == (server)peerptr != ((void *)0)(((servers) != ((void *)0)) && (((const isc__magic_t *)(servers))->magic == ((('s') << 24 | ('e') << 16 | ('R') << 8 | ('L')))))portlist.cxtry <= maxxtry >= min(((portlist) != ((void *)0)) && (((const isc__magic_t *)(portlist))->magic == ((('P') << 24 | ('L') << 16 | ('S') << 8 | ('T')))))portlistp != ((void *)0) && *portlistp == ((void *)0)(&portlist->refcount)->refs > 0af == 2 || af == 10((*((&portlist->lock)))++ == 0 ? 0 : 34) == 0(--(*((&portlist->lock))) == 0 ? 0 : 34) == 0portlistp != ((void *)0)(&portlist->refcount)->refs == 0(*((&portlist->lock)) == 0 ? (*((&portlist->lock)) = -1, 0) : 34) == 0rbt.c(((rbt) != ((void *)0)) && (((const isc__magic_t *)(rbt))->magic == ((('R') << 24 | ('B') << 16 | ('T') << 8 | ('+')))))name->offsets == ((void *)0)((bucket_node)->hashnext) != ((void *)0)rootp != ((void *)0)child != ((void *)0)(((chain) != ((void *)0)) && (((const isc__magic_t *)(chain))->magic == ((('0') << 24 | ('-') << 16 | ('0') << 8 | ('-')))))(((chain) != ((void *)0)) && (((const isc__magic_t *)(chain))->magic == ((('0') << 24 | ('-') << 16 | ('0') << 8 | ('-'))))) && chain->end != ((void *)0)chain->level_count > 0 && (((current)->is_root == 1) ? isc_boolean_true : isc_boolean_false)chain != ((void *)0)REDblack (%s from (BAD parent pointer! -> ++ BEG down from -- END down from ** Red/Red color violation on left** Red/Red color violation on rightprintname != ((void *)0)rbtp != ((void *)0) && (((*rbtp) != ((void *)0)) && (((const isc__magic_t *)(*rbtp))->magic == ((('R') << 24 | ('B') << 16 | ('T') << 8 | ('+')))))rbt->nodecount == 0dns_rbt_destroy2(rbtp, 0) == 0dns_rbt_deletetree(rbt, ((node)->down)) == 0((((delete)->is_root == 1) ? isc_boolean_true : isc_boolean_false) && *rootp == delete) || (! (((delete)->is_root == 1) ? isc_boolean_true : isc_boolean_false) && (((((delete)->parent))->left) == delete || ((((delete)->parent))->right) == delete))! (((delete)->is_root == 1) ? isc_boolean_true : isc_boolean_false)child == ((void *)0) || ! (((child)->is_root == 1) ? isc_boolean_true : isc_boolean_false)(node)->references == 0node != ((void *)0) && *node == ((void *)0)(options & (0x02 | 0x04)) != (0x02 | 0x04)current == current_rootcompared == dns_namereln_commonancestor || compared == dns_namereln_containschain->level_matches > 0((options & 0x02) != 0) || ((options & 0x01) == 0 && ((current)->data) == ((void *)0))chain->level_count > 0chain->level_matches < chain->level_countorder < 0data != ((void *)0) && *data == ((void *)0)name->offsets != ((void *)0)(((*root)->is_root == 1) ? isc_boolean_true : isc_boolean_false)*root == ((void *)0) || ((((*root)->is_root == 1) ? isc_boolean_true : isc_boolean_false) && ((*root)->parent) == current)isc_boolean_true && ((node)->left) == ((void *)0) && ((node)->right) == ((void *)0)((current)->left) == ((void *)0)((current)->right) == ((void *)0)((node)->parent) == ((void *)0)(((root)->is_root == 1) ? isc_boolean_true : isc_boolean_false)rbtp != ((void *)0) && *rbtp == ((void *)0)deleter == ((void *)0) ? deleter_arg == ((void *)0) : 1rbtdb.c((rbtdb) != ((void *)0) && (rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('4')))(&rbtdb->references)->refs > 0(&rbtversion->references)->refs > 0refs > 1lockrefs != 0noderefs != 0(((rbtdb)->common.attributes & 0x01) != 0)((void *)((header)->lru_link.prev) != (void *)(-1))(rbtdb->rdatasets[header->node->locknum]).tail == (header)(rbtdb->rdatasets[header->node->locknum]).head == (header)rbtdbiter->tree_locked != isc_rwlocktype_none((*((&rbtdb->node_locks[node->locknum].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[node->locknum].lock))) == 0 ? 0 : 34) == 0header != ((void *)0)((*((&rbtdb->node_locks[rbtnode->locknum].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[rbtnode->locknum].lock))) == 0 ? 0 : 34) == 0((*((&rbtdb->node_locks[onode->locknum].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[onode->locknum].lock))) == 0 ? 0 : 34) == 0!(((rbtdb)->common.attributes & 0x01) != 0)(node)->references > 0((*((&rbtdb->lock)))++ == 0 ? 0 : 34) == 0version->writer(--(*((&rbtdb->lock))) == 0 ? 0 : 34) == 0(&version->references)->refs > 0array[i].entry == ((void *)0) && array[i].cbarg == ((void *)0)rbtdb->future_version == ((void *)0)rbtdb->next_serial != 0cbargp != ((void *)0) && *cbargp != ((void *)0)total_count > current_count((*((nodelock)))++ == 0 ? 0 : 34) == 0(--(*((nodelock))) == 0 ? 0 : 34) == 0arg != ((void *)0)acarray[count].cbarg == cbargacarray[count].cbarg != ((void *)0)zone_findzonecut() called!rbtdbiter->pausedrbtdbiter->tree_locked == isc_rwlocktype_noneisc_rwlock_lock((&rbtdb->tree_lock), (isc_rwlocktype_read)) == 0((*((&(search->rbtdb->node_locks[node->locknum].lock))))++ == 0 ? 0 : 34) == 0(--(*((&(search->rbtdb->node_locks[node->locknum].lock)))) == 0 ? 0 : 34) == 0dns_name_copy(name, zcname, ((void *)0)) == 0isc_rwlock_unlock((&rbtdb->tree_lock), (isc_rwlocktype_read)) == 0n >= 2((*((&(rbtdb->node_locks[node->locknum].lock))))++ == 0 ? 0 : 34) == 0(--(*((&(rbtdb->node_locks[node->locknum].lock)))) == 0 ? 0 : 34) == 0(rbtdb->deadnodes[bucketnum]).tail == (node)(rbtdb->deadnodes[bucketnum]).head == (node)((node)->references) == 0 && node->data == ((void *)0)cleanup_dead_nodes: dns_rbt_deletenode: %s(rbtdb->rdatasets[idx]).tail == (rdataset)(rbtdb->rdatasets[idx]).head == (rdataset)((*((lock)))++ == 0 ? 0 : 34) == 0(--(*((lock))) == 0 ? 0 : 34) == 0search->zonecut == ((void *)0)(int)nrefs >= 0(&nodelock->references)->refs > 0(int)refs >= 0least_serial != 0dcurrent->serial <= dparent->serialdcurrent->serial <= least_serialresult == 0 || result == 17decrement_reference: delete from rbt: %p %sdecrement_reference: dns_rbt_deletenode: %s!((void *)((node)->deadlink.prev) != (void *)(-1))isc_rwlock_unlock((&rbtdb->tree_lock), (isc_rwlocktype_write)) == 0rbtdbiter->node != ((void *)0)flush_deletions: %d nodes of %d in treeisc_rwlock_lock((&rbtdb->tree_lock), (isc_rwlocktype_write)) == 0rbtdbiter->tree_locked == isc_rwlocktype_readrbtversion != ((void *)0)rbtversion->serial >= header->serialrbtversion == ((void *)0) || rbtversion->serial >= topheader->serial!loadingdbloadp != ((void *)0)loadctx->rbtdb == rbtdb(rbtdb->attributes & 0x02) != 0(rbtdb->attributes & 0x01) == 0!version->writerversion->commit_okversion == rbtdb->future_version(&cur_version->references)->refs > 0(((cur_version->changed_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(rbtdb->open_versions).tail == (cur_version)(rbtdb->open_versions).head == (cur_version)(version->changed_list).tail == (changed)(version->changed_list).head == (changed)cur_ref == 1version->serial < least_greater->serial(((version->changed_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(rbtdb->open_versions).tail == (version)(rbtdb->open_versions).head == (version)(((cleanup_version->changed_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)((search.rbtdb) != ((void *)0) && (search.rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('4')))isc_rwlock_lock((&search.rbtdb->tree_lock), (isc_rwlocktype_read)) == 0((*((&(search.rbtdb->node_locks[node->locknum].lock))))++ == 0 ? 0 : 34) == 0(--(*((&(search.rbtdb->node_locks[node->locknum].lock)))) == 0 ? 0 : 34) == 0isc_rwlock_unlock((&search.rbtdb->tree_lock), (isc_rwlocktype_read)) == 0rbtversion->serial >= topheader->serial(rbtdb->attributes & (0x01|0x02)) == 0(rbtnode)->references > 0result == 23node %p, %u references, locknum = %u type %u serial = %lu, ttl = %u, trust = %u, attributes = %u (empty) FORCEcheckovermem cache: %s %sovermem cache: stale %sovermem cache: reprieve by RETAIN() %sovermem cache: saved %srbtdbiter->result == 0isc_rwlock_lock((&rbtdb->tree_lock), (locktype)) == 0isc_rwlock_unlock((&rbtdb->tree_lock), (locktype)) == 0(rbtdb->deadnodes[node->locknum]).tail == (node)(rbtdb->deadnodes[node->locknum]).head == (node)rbtdb->current_version != ((void *)0) || (((rbtdb->open_versions).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(&rbtdb->current_version->references)->refs > 0(rbtdb->open_versions).tail == (rbtdb->current_version)(rbtdb->open_versions).head == (rbtdb->current_version)(&rbtdb->current_version->references)->refs == 0(rbtdb->deadnodes[i]).tail == (node)(rbtdb->deadnodes[i]).head == (node)rbtdb->task != ((void *)0)adjust_quantum -> %dresult == 0 && rbtdb->tree == ((void *)0)done free_rbtdb(%s)(&rbtdb->node_locks[i].references)->refs == 0(*((&rbtdb->node_locks[i].lock)) == 0 ? (*((&rbtdb->node_locks[i].lock)) = -1, 0) : 34) == 0(((rbtdb->rdatasets[i]).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((rbtdb->deadnodes[i]).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(&rbtdb->references)->refs == 0(*((&rbtdb->lock)) == 0 ? (*((&rbtdb->lock)) = -1, 0) : 34) == 0rbtdb->node_lock_count < (1 << 10)(&rbtdb->node_locks[i].references)->refs > 0result != 18targetp != ((void *)0) && *targetp != ((void *)0)((*((&nodelock->lock)))++ == 0 ? 0 : 34) == 0(--(*((&nodelock->lock))) == 0 ? 0 : 34) == 0calling free_rbtdb(%s)((*((&rbtdb->node_locks[i].lock)))++ == 0 ? 0 : 34) == 0(--(*((&rbtdb->node_locks[i].lock))) == 0 ? 0 : 34) == 0!search.need_cleanupversion == ((void *)0)victim->node->locknum == rbtnode->locknumrbtnode != victim->node((rbtdb) != ((void *)0) && (rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('8')))((search.rbtdb) != ((void *)0) && (search.rbtdb)->common.impmagic == (('R') << 24 | ('B') << 16 | ('D') << 8 | ('8')))rdataslab.cslab != ((void *)0)tslabp != ((void *)0) && *tslabp == ((void *)0)mslab != ((void *)0) && sslab != ((void *)0)mcount > 0 && scount > 0tcurrent == tstart + tlengthoslab != ((void *)0) && nslab != ((void *)0)ocount > 0 && ncount > 0ocount != 0request.c(((request) != ((void *)0)) && (((const isc__magic_t *)(request))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('!')))))mgr_gethash(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('M')))))dns_requestmgr_attach: %p: eref %d iref %dmgr_destroyrequestmgr->eref == 0requestmgr->iref == 0(*((&requestmgr->lock)) == 0 ? (*((&requestmgr->lock)) = -1, 0) : 34) == 0(*((&requestmgr->locks[i])) == 0 ? (*((&requestmgr->locks[i])) = -1, 0) : 34) == 0requestmgrp != ((void *)0)(((requestmgr) != ((void *)0)) && (((const isc__magic_t *)(requestmgr))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('M')))))((*((&requestmgr->lock)))++ == 0 ? 0 : 34) == 0requestmgr->eref > 0dns_requestmgr_detach: %p: eref %d iref %drequestmgr->exiting && ((requestmgr->requests).head) == ((void *)0)(--(*((&requestmgr->lock))) == 0 ? 0 : 34) == 0req_sendevent: request %psend_shutdown_events: %p(requestmgr->whenshutdown).tail == (event)(requestmgr->whenshutdown).head == (event)req_destroy: request %prequestmgr->iref > 0((requestmgr->requests).head) == ((void *)0)requestp != ((void *)0) && (((*requestp) != ((void *)0)) && (((const isc__magic_t *)(*requestp))->magic == ((('R') << 24 | ('q') << 16 | ('u') << 8 | ('!')))))dns_request_destroy: request %p((*((&request->requestmgr->lock)))++ == 0 ? 0 : 34) == 0((*((&request->requestmgr->locks[request->hash])))++ == 0 ? 0 : 34) == 0(request->requestmgr->requests).tail == (request)(request->requestmgr->requests).head == (request)!(((request)->flags & 0x0001) != 0)!(((request)->flags & 0x0002) != 0)(--(*((&request->requestmgr->locks[request->hash]))) == 0 ? 0 : 34) == 0(--(*((&request->requestmgr->lock))) == 0 ? 0 : 34) == 0!((void *)((request)->link.prev) != (void *)(-1))request->dispentry == ((void *)0)request->dispatch == ((void *)0)request->timer == ((void *)0)request->answer != ((void *)0)dns_request_getresponse: request %pdns_request_cancel: request %pdns_requestmgr_shutdown: %p(((requestmgr->requests).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)dns_requestmgr_whenshutdownblackholed address %sreq_cancel: request %p(((request)->flags & 0x0002) != 0)req_senddone: request %pevent->ev_type == (((4) << 16) + 33)req_response: request %p: %sreq_send: request %preq_timeout: request %pdestaddr != ((void *)0)requestp != ((void *)0) && *requestp == ((void *)0)timeout > 0isc_sockaddr_pf(srcaddr) == isc_sockaddr_pf(destaddr)dns_request_createviasocket != ((void *)0)bufferp != ((void *)0) && *bufferp == ((void *)0)request_renderdns_request_createvia: request %p(requestmgr->requests).tail == (request)(requestmgr->requests).head == (request)dns_request_createvia: failed %smsgbuf != ((void *)0)dns_request_createrawdns_request_createraw: request %pdns_request_createraw: failed %s(((request)->flags & 0x0001) != 0)req_connected: request %pdns_requestmgr_createrequestmgrp != ((void *)0) && *requestmgrp == ((void *)0)socketmgr != ((void *)0)isc_socket_gettype(socket) == isc_sockettype_udpdns_requestmgr_create: %psoa.crdata->type == ((dns_rdatatype_t)dns_rdatatype_soa)rdata->length >= 20offset >= 0 && offset <= 16ssu.c(((rule) != ((void *)0)) && (((const isc__magic_t *)(rule))->magic == ((('S') << 24 | ('S') << 16 | ('U') << 8 | ('R')))))types != ((void *)0) && *types != ((void *)0)(((table) != ((void *)0)) && (((const isc__magic_t *)(table))->magic == ((('S') << 24 | ('S') << 16 | ('U') << 8 | ('T')))))rule != ((void *)0) && *rule == ((void *)0)nextrule != ((void *)0) && *nextrule == ((void *)0)signer == ((void *)0) || dns_name_isabsolute(signer)dns_name_isabsolute(identity)matchtype <= 9dns_name_iswildcard(name)types != ((void *)0)tablep != ((void *)0) && *tablep == ((void *)0)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('S') << 24 | ('S') << 16 | ('U') << 8 | ('T')))))tablep != ((void *)0)((*((&table->lock)))++ == 0 ? 0 : 34) == 0table->references > 0(--(*((&table->lock))) == 0 ? 0 : 34) == 0(table->rules).tail == (rule)(table->rules).head == (rule)(*((&table->lock)) == 0 ? (*((&table->lock)) = -1, 0) : 34) == 0tcpmsg.csock != ((void *)0)tcpmsg != ((void *)0)(((tcpmsg) != ((void *)0)) && (((const isc__magic_t *)(tcpmsg))->magic == ((('T') << 24 | ('C') << 16 | ('P') << 8 | ('m')))))maxsize < 65536tcpmsg->task == ((void *)0)xfrin.ctransfer of '%s' from %s: %s(((xfr) != ((void *)0)) && (((const isc__magic_t *)(xfr))->magic == ((('X') << 24 | ('f') << 16 | ('r') << 8 | ('I')))))Transfer completed: %d messages, %d records, %llu bytes, %u.%03u secs (%u bytes/sec)xfr->refcount > 0shut downgiving upfailed setting up socketxfrp != ((void *)0) && *xfrp == ((void *)0)isc_sockaddr_pf(masteraddr) == isc_sockaddr_pf(sourceaddr)zone transfer setup failedsent request length prefixfailed sending request length prefixrequesting IXFR for serial %u(rdl->rdata).tail == (rdata)(rdl->rdata).head == (rdata)region.length <= 65535connected using %sfailed to connectsent request datafailed sending request dataev->ev_type == (((4) << 16) + 7)received %u bytesgot %s, retrying with AXFRresettingempty answer section, retrying with AXFRTSIG check failed: %snon-SOA response to SOA queryrequested serial %u, master has %u, not updatingfirst RR in zone transfer must be SOAgot incremental responsegot incremental response to AXFR requestxfr->db != ((void *)0)got nonincremental responseIXFR out of sync: expected serial %u, got %ufailed while receiving responseszonekey.ckeyrdata != ((void *)0)libdst.cat%s dst_parse.cpriv != ((void *)0)%s v%d.%d Private-key-format:%s %d Algorithm:(RSA) (DH) (DSA) (RSASHA1) (HMAC_MD5) (HMAC_SHA1) (HMAC_SHA224) (HMAC_SHA256) (HMAC_SHA384) (HMAC_SHA512) (?) v%d.%dModulus:PublicExponent:PrivateExponent:Prime1:Prime2:Exponent1:Exponent2:Coefficient:Prime(p):Generator(g):Private_value(x):Public_value(y):Subprime(q):Base(g):Key:Bits:***+ ++ +,+ <+!H+"X+#l+0<+1+2+3X+4l+ + + + + +! +0 +1 +@ +A +P +Q +GSSAPI error: Major = %u, Minor = %u.diff.c(((t) != ((void *)0)) && (((const isc__magic_t *)(t))->magic == ((('D') << 24 | ('I') << 16 | ('F') << 8 | ('T')))))diff_tuple_tordataset failed: %sbuf.used >= 1 && ((char *) buf.base)[buf.used-1] == '\n'adddel%s %.*s %s %.*s(diff->tuples).tail == (p)(diff->tuples).head == (p)((diff->tuples).head) == ((void *)0)op == DNS_DIFFOP_ADDupdate with no effect'%s/%s/%s': TTL differs in rdataset, adjusting %lu -> %lu(((*tuplep) != ((void *)0)) && (((const isc__magic_t *)(*tuplep))->magic == ((('D') << 24 | ('I') << 16 | ('F') << 8 | ('T')))))(diff->tuples).tail == (ot)(diff->tuples).head == (ot)unexpected non-minimal diff(diff->tuples).tail == (t)(diff->tuples).head == (t)(((diff->tuples).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)tp != ((void *)0) && *tp == ((void *)0)datap == (unsigned char *)t + sizegetaddresses.chostname != ((void *)0)addrs != ((void *)0)addrcount != ((void *)0)addrsize > 0%u.%u.%u.%u0INVARIANTREQUIREENSUREINSIST%s:%d: %s(%s) %s. base64.cABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=buffer.c(((b) != ((void *)0)) && (((const isc__magic_t *)(b))->magic == (0x42756621U)))!((void *)((b)->link.prev) != (void *)(-1))b->mctx == ((void *)0)b->used + n <= b->lengthb->used >= nb->current + n <= b->usedn <= b->currentb->used - b->current >= 1b->used + 1 <= b->lengthb->used - b->current >= 2b->used + 2 <= b->lengthb->used - b->current >= 4b->used + 4 <= b->lengthb->used - b->current >= 6b->used + 6 <= b->lengthdynbuffer != ((void *)0)(((*dynbuffer) != ((void *)0)) && (((const isc__magic_t *)(*dynbuffer))->magic == (0x42756621U)))(*dynbuffer)->mctx != ((void *)0)*dynbuffer == ((void *)0)b->used + length <= b->lengthl <= ((b)->length - (b)->used)b->length <= lengthbase != ((void *)0)RUNTIME_CHECK(%s) %sfatal error%s:%d: %s: %s:%d: event.csize >= sizeof(struct isc_event)hash.c((((hctx)) != ((void *)0)) && (((const isc__magic_t *)((hctx)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))hctxp != ((void *)0) && *hctxp == ((void *)0)(&hctx->refcnt)->refs > 0hctxp != ((void *)0) && *hctxp != ((void *)0)((*((&hctx->lock)))++ == 0 ? 0 : 34) == 0(&hctx->refcnt)->refs == 0(--(*((&hctx->lock))) == 0 ? 0 : 34) == 0(*((&hctx->lock)) == 0 ? (*((&hctx->lock)) = -1, 0) : 34) == 0hash != ((void *)0) && ((((hash)) != ((void *)0)) && (((const isc__magic_t *)((hash)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))(&hash->refcnt)->refs > 0hctxp != ((void *)0) && ((((*hctxp)) != ((void *)0)) && (((const isc__magic_t *)((*hctxp)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))p == (unsigned char *)hctx->rndvector + hctx->vectorlenkeylen <= hash->limithctx != ((void *)0) && ((((hctx)) != ((void *)0)) && (((const isc__magic_t *)((hctx)))->magic == ((('H') << 24 | ('a') << 16 | ('s') << 8 | ('h')))))keylen <= hctx->limithash == ((void *)0)((*((&createlock)))++ == 0 ? 0 : 34) == 0(--(*((&createlock))) == 0 ? 0 : 34) == 0  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~heap.c((i) == 1 || ! heap->compare(heap->array[(i)], heap->array[((i) >> 1)]))(((heap) != ((void *)0)) && (((const isc__magic_t *)(heap))->magic == ((('H') << 24 | ('E') << 16 | ('A') << 8 | ('P')))))index >= 1 && index <= heap->lastindex >= 1heapp != ((void *)0) && *heapp == ((void *)0)compare != ((void *)0)heapp != ((void *)0)hex.c0123456789ABCDEFhmacmd5.clen <= 16Uhmacsha.clen <= 64Ulen <= 48Ulen <= 32Ulen <= 28Ulen <= 20Ulex.c(((lex) != ((void *)0)) && (((const isc__magic_t *)(lex))->magic == ((('L') << 24 | ('e') << 16 | ('x') << 8 | ('!')))))source->pushback->current > 0tokenp != ((void *)0)((source->pushback)->current) != 0 || tokenp->type == isc_tokentype_eofsource->ignored <= ((source->pushback)->current)remaining > 0Uprev != ((void *)0)(lex->sources).tail == (source)(lex->sources).head == (source)buffer-%pstream-%plexp != ((void *)0)isc_lex_close(lex) == 0lexp != ((void *)0) && *lexp == ((void *)0)max_token > 0Ulibisc.cat%s%s%s%s%s%s%s%s%s%s %s%s%s%s%s%s%s%s%s%slctx->logconfig != ((void *)0)categories != ((void *)0) && categories[0].name != ((void *)0)modules != ((void *)0) && modules[0].name != ((void *)0)(((lcfg) != ((void *)0)) && (((const isc__magic_t *)(lcfg))->magic == ((('L') << 24 | ('c') << 16 | ('f') << 8 | ('g')))))(((lcfg) != ((void *)0)) && (((const isc__magic_t *)(lcfg))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))lcfgp != ((void *)0) && (((*lcfgp) != ((void *)0)) && (((const isc__magic_t *)(*lcfgp))->magic == ((('L') << 24 | ('c') << 16 | ('f') << 8 | ('g')))))lcfg->lctx != ((void *)0) && lcfg->lctx->logconfig != lcfg(lcfg->channels).tail == (channel)(lcfg->channels).head == (channel)(lcfg->channellists[i]).tail == (item)(lcfg->channellists[i]).head == (item)lctxp != ((void *)0) && (((*lctxp) != ((void *)0)) && (((const isc__magic_t *)(*lctxp))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))(lctx->messages).tail == (message)(lctx->messages).head == (message)type == 2 || type == 3 || type == 4 || type == 1destination != ((void *)0) || type == 1level >= (-5)(flags & (unsigned int)~(0x001F | 0x1000)) == 0default_stderrlcfgp != ((void *)0) && *lcfgp == ((void *)0)default_syslogdefault_debuglctx == ((void *)0) || (((lctx) != ((void *)0)) && (((const isc__magic_t *)(lctx))->magic == ((('L') << 24 | ('c') << 16 | ('t') << 8 | ('x')))))category != ((void *)0)module != ((void *)0)level != 0format != ((void *)0)category->id < lctx->category_countmodule->id < lctx->module_countisc_time_now((&isctime)) == 0level %d: %s %d: isc_time_now((&oldest)) == 0isc_time_now((&new->time)) == 0channel->type == 3(channel->destination.file.stream) == ((void *)0)path != ((void *)0) && *path != '\0'%s.%dunable to remove log file '%s.%d': %sunable to rename log file '%s.%d' to '%s.%d': %s%s.0unable to rename log file '%s' to '%s.0': %sunable to remove log file '%s': %sisc_log_open: roll_log '%s' failed: %sisc_log_open '%s' failed: %slctx->category_count != 0category_id < lctx->category_countmodule == ((void *)0) || module->id < lctx->module_countchannel != ((void *)0)category == ((void *)0) || category->id < lctx->category_countlcfg->lctx == lctxlcfgp == ((void *)0) || *lcfgp == ((void *)0)defaultgeneralinterfaceinfonoticecritical4CGG]Gmem.cctx->inuse >= sizectx->stats[ctx->max_size].gets > 0Uctx->stats[size].gets > 0U(((ctx) != ((void *)0)) && (((const isc__magic_t *)(ctx))->magic == ((('M') << 24 | ('e') << 16 | ('m') << 8 | ('C')))))(((mpctx) != ((void *)0)) && (((const isc__magic_t *)(mpctx))->magic == ((('M') << 24 | ('E') << 16 | ('M') << 8 | ('p')))))mpctx->lock == ((void *)0)lock != ((void *)0)((*((mpctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((mpctx->lock))) == 0 ? 0 : 34) == 0limit > 0hiwater >= lowater((*((&ctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&ctx->lock))) == 0 ? 0 : 34) == 0(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('M') << 24 | ('e') << 16 | ('m') << 8 | ('C')))))Dump of all outstanding memory allocations: ptr %p size %u file %s line %u None. ((*((&lock)))++ == 0 ? 0 : 34) == 0context: %p (--(*((&lock))) == 0 ? 0 : 34) == 0file != ((void *)0)del %p size %u file %s line %u mctx %p dl->count > 0(mctx->debuglist[size]).tail == (dl)(mctx->debuglist[size]).head == (dl)dl != ((void *)0)((unsigned char *)mem)[size] == 0xbectx->stats[ctx->max_size].gets != 0Usize <= ctx->total*cp == 0xbectx->stats[size].gets != 0Umpctx->allocated > 0((*((&mctx->lock)))++ == 0 ? 0 : 34) == 0(--(*((&mctx->lock))) == 0 ? 0 : 34) == 0si->u.ctx == ctxoldsize == sizectx->basic_table_count <= ctx->basic_table_sizeadd %p size %u file %s line %u mctx %p mpctx->freecount > 0maxinuse = %lu (((mctx) != ((void *)0)) && (((const isc__magic_t *)(mctx))->magic == ((('M') << 24 | ('e') << 16 | ('m') << 8 | ('C')))))mpctxp != ((void *)0) && *mpctxp == ((void *)0)mpctxp != ((void *)0)isc_mempool_destroy(): mempool %s leaked memorympctx->allocated == 0(mctx->pools).tail == (mpctx)(mctx->pools).head == (mpctx) >=%s%5lu: %11lu gets, %11lu rem (%lu bl, %lu ff)[Pool statistics] maxallocallocatedfreecountfreemaxfillcountgets%15s %10s %10s %10s %10s %10s %10s %10s %1s %15s %10lu %10u %10u %10u %10u %10u %10u %s (contexts).tail == (ctx)(contexts).head == (ctx)(((ctx->pools).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((ctx->debuglist[i]).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(ctx->debuglist[i]).tail == (dl)(ctx->debuglist[i]).head == (dl)ctx->references == 0ctx->stats[i].gets == 0U(*((&ctx->lock)) == 0 ? (*((&ctx->lock)) = -1, 0) : 34) == 0ctxp != ((void *)0)ctx->references == 1ctx->references > 0ctxp != ((void *)0) && *ctxp == ((void *)0)memalloc != ((void *)0)memfree != ((void *)0)netaddr.cnetaddr->family == 10s->family == 10((((__const uint32_t *) (&src->type.in6))[0] == 0) && (((__const uint32_t *) (&src->type.in6))[1] == 0) && (((__const uint32_t *) (&src->type.in6))[2] == (__extension__ ({ register unsigned int __bsx = (0xffff); ((((__bsx) & 0xff000000u) >> 24) | (((__bsx) & 0x00ff0000u) >> 8) | (((__bsx) & 0x0000ff00u) << 8) | (((__bsx) & 0x000000ffu) << 24)); }))))a != ((void *)0) && b != ((void *)0)nbytes < ipabytesnbits < 8netaddr != ((void *)0)alen < sizeof(abuf)%%%u(unsigned int)zlen < sizeof(zbuf)ondestroy.c(((ondest) != ((void *)0)) && (((const isc__magic_t *)(ondest))->magic == ((('D') << 24 | ('e') << 16 | ('S') << 8 | ('t')))))(ondest->events).tail == (eventp)(ondest->events).head == (eventp)theevent != ((void *)0)radix.cfunc != ((void *)0)(&prefix->refcount)->refs > 0(&prefix->refcount)->refs == 0radix != ((void *)0)radix->head == nodeparent->l == noderadix->head == parentparent->parent->l == parentXrn->data[0] == ((void *)0) && Xrn->data[1] == ((void *)0)radix->num_active_node == 0maxbits <= 128prefix != ((void *)0)(prefix->family == 2 && prefix->bitlen <= 32) || (prefix->family == 10 && prefix->bitlen <= 128)prefix != ((void *)0) || (source != ((void *)0) && source->prefix != ((void *)0))prefix == ((void *)0) || prefix->bitlen <= radix->maxbitsnode->prefix != ((void *)0)j < 8node->data[0] == ((void *)0) && node->node_num[0] == -1 && node->data[1] == ((void *)0) && node->node_num[1] == -1glue == ((void *)0)node->r == ((void *)0)node->l == ((void *)0)glue != ((void *)0)prefix->bitlen <= radix->maxbitsrandom.cjitter < maxval != ((void *)0)ratelimiter.c((*((&rl->lock)))++ == 0 ? 0 : 34) == 0(--(*((&rl->lock))) == 0 ? 0 : 34) == 0rl->refs > 0(*((&rl->lock)) == 0 ? (*((&rl->lock)) = -1, 0) : 34) == 0eventp != ((void *)0) && *eventp != ((void *)0)ev->ev_sender == ((void *)0)rl->state == isc_ratelimiter_shuttingdown(rl->pending).tail == (ev)(rl->pending).head == (ev)ratelimiterp != ((void *)0) && *ratelimiterp == ((void *)0)(rl->pending).tail == (p)(rl->pending).head == (p)refcount.cref != ((void *)0)region.cr1 != ((void *)0)r2 != ((void *)0)base % 65536 == 0nresults <= 65536register_table() %s: %u(result code text not available)out of memorytimed outno available threadsaddress not availableaddress in usepermission deniedno pending connectionsnetwork unreachablehost unreachablenetwork downhost downconnection refusednot enough free resourcesend of filesocket already boundreloadlock busyalready existsran out of spaceoperation canceledsocket is not boundunexpected end of inputI/O errornot implementedunbalanced parenthesesno moreinvalid filebad base64 encodingunexpected tokenquota reachedunexpected erroralready runningaddress mask not contiguousfile not foundfile already existssocket is not connectedout of rangeout of entropyinvalid use of multicast addressnot a filenot a directoryqueue is fulladdress family mismatchaddress family not supportedbad hex encodingtoo many open filesnot blockingunbalanced quotesoperation in progressconnection resetsoft quota reachednot a valid numberdisabledmax sizeinvalid address formatrwlock.crwl != ((void *)0)(((rwl) != ((void *)0)) && (((const isc__magic_t *)(rwl))->magic == ((('R') << 24 | ('W') << 16 | ('L') << 8 | ('k')))))rwl->type == isc_rwlocktype_readrwl->active != 0rwl->type == isc_rwlocktype_writerwl->active == 1rwl->type == typerwl->active > 0rwl->active == 0sha1.ccontext != ((void *)0)state != ((void *)0)context != 0data != 0digest != 0sha2.ccontext != (isc_sha384_t *)0context != (isc_sha512_t *)0context != (isc_sha256_t *)0context != (isc_sha512_t *)0 && data != (isc_uint8_t*)0context != (isc_sha256_t *)0 && data != (isc_uint8_t*)0context != (isc_sha224_t *)00123456789abcdef$b؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[؞|6p09Y1 XhdOsockaddr.cunknown address family: %dsockaddr != ((void *)0)plen < sizeof(pbuf)#avail.length >= 1string.cstrlen(target) < sizetask.c(((task->events).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)task->state == task_state_ready || task->state == task_state_running(task->on_shutdown).tail == (event)(task->on_shutdown).head == (event)task->references > 0event->ev_type > 0task->state != task_state_done(((task) != ((void *)0)) && (((const isc__magic_t *)(task))->magic == ((('T') << 24 | ('A') << 16 | ('S') << 8 | ('K')))))((*((&task->lock)))++ == 0 ? 0 : 34) == 0(--(*((&task->lock))) == 0 ? 0 : 34) == 0last >= first(task->events).tail == (event)(task->events).head == (event)(((manager) != ((void *)0)) && (((const isc__magic_t *)(manager))->magic == ((('T') << 24 | ('S') << 16 | ('K') << 8 | ('M')))))task->state == task_state_ready((*((&manager->lock)))++ == 0 ? 0 : 34) == 0(--(*((&manager->lock))) == 0 ? 0 : 34) == 0taskp != ((void *)0)!(idle1 && idle2)(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('T') << 24 | ('A') << 16 | ('S') << 8 | ('K')))))(manager->ready_tasks).tail == (task)(manager->ready_tasks).head == (task)!was_idle(((task->on_shutdown).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)task->references == 0task->state == task_state_done(manager->tasks).tail == (task)(manager->tasks).head == (task)(*((&task->lock)) == 0 ? (*((&task->lock)) = -1, 0) : 34) == 0workers > 0managerp != ((void *)0) && *managerp == ((void *)0)taskp != ((void *)0) && *taskp == ((void *)0)(task->events).tail == (curr_event)(task->events).head == (curr_event)managerp != ((void *)0)!manager->exiting(((manager->tasks).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&manager->lock)) == 0 ? (*((&manager->lock)) = -1, 0) : 34) == 0taskpool.ctaskpooltimer.c(((timer) != ((void *)0)) && (((const isc__magic_t *)(timer))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('R')))))timerp != ((void *)0) && *timerp == ((void *)0)((*((&timer->lock)))++ == 0 ? 0 : 34) == 0(--(*((&timer->lock))) == 0 ? 0 : 34) == 0(((t1) != ((void *)0)) && (((const isc__magic_t *)(t1))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('R')))))(((t2) != ((void *)0)) && (((const isc__magic_t *)(t2))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('R')))))manager->nscheduled > 0timer->type != isc_timertype_inactiveresult == 1couldn't allocate eventcouldn't schedule timer: %u(((manager) != ((void *)0)) && (((const isc__magic_t *)(manager))->magic == ((('T') << 24 | ('I') << 16 | ('M') << 8 | ('M')))))(((manager->timers).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)timerp != ((void *)0)timer->references > 0(manager->timers).tail == (timer)(manager->timers).head == (timer)(*((&timer->lock)) == 0 ? (*((&timer->lock)) = -1, 0) : 34) == 0type == isc_timertype_inactive || !(isc_time_isepoch(expires) && isc_interval_iszero(interval))type != isc_timertype_limited || !(isc_time_isepoch(expires) || isc_interval_iszero(interval))app.cin_recursive_evloop!blockedblocked(*((&lock)) == 0 ? (*((&lock)) = -1, 0) : 34) == 0isc_app_reload() kill: %sisc_app_shutdown() kill: %shandle_signal() %d setup: %s(on_run).tail == (event)(on_run).head == (event)!in_recursive_evloop*mp == 1isc_app_start() sigsetops: %sisc_app_start() sigprocmask: %sdir.cdir != ((void *)0)templet != ((void *)0)dirname != ((void *)0)(((dir) != ((void *)0)) && (((const isc__magic_t *)(dir))->magic == ((('D') << 24 | ('I') << 16 | ('R') << 8 | ('*'))))) && dir->handle != ((void *)0)(((dir) != ((void *)0)) && (((const isc__magic_t *)(dir))->magic == ((('D') << 24 | ('I') << 16 | ('R') << 8 | ('*')))))../entropy.c(((source) != ((void *)0)) && (((const isc__magic_t *)(source))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('s')))))source->type == 3(((ent) != ((void *)0)) && (((const isc__magic_t *)(ent))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('e')))))entp != ((void *)0) && *entp == ((void *)0)((*((&ent->lock)))++ == 0 ? 0 : 34) == 0(--(*((&ent->lock))) == 0 ? 0 : 34) == 0entropy.cfcntl(%d, F_SETFL, %d): %sstop typing. isc_time_now((&t)) == 0You must use the keyboard to create entropy, since your system is lacking /dev/random (or equivalent) start typing: sourcep != ((void *)0) && *sourcep == ((void *)0)get != ((void *)0)(((ectx) != ((void *)0)) && (((const isc__magic_t *)(ectx))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('e')))))source != ((void *)0) && *source == ((void *)0)use_keyboard == 1 || use_keyboard == 2 || use_keyboard == 3/dev/randomsq->samples != ((void *)0)sq->extra != ((void *)0)(ent->sources).tail == (source)(ent->sources).head == (source)ent->nsources > 0entp != ((void *)0) && *entp != ((void *)0)ent->refcnt == 0(((ent->sources).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(*((&ent->lock)) == 0 ? (*((&ent->lock)) = -1, 0) : 34) == 0entp != ((void *)0) && (((*entp) != ((void *)0)) && (((const isc__magic_t *)(*entp))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('e')))))ent->refcnt > 0sourcep != ((void *)0)(((*sourcep) != ((void *)0)) && (((const isc__magic_t *)(*sourcep))->magic == ((('E') << 24 | ('n') << 16 | ('t') << 8 | ('s')))))Entropy pool %p: refcnt %u cursor %u, rotate %u entropy %u pseudo %u nsources %u nextsource %p initialized %u initcount %u !blockingn == 2!partial || returned != ((void *)0)errno2result.cunable to convert errno to isc_result: %d: %sfile.clength > 0Ustats != ((void *)0)pathname != ((void *)0)oldname != ((void *)0)newname != ((void *)0)fp != ((void *)0) && *fp == ((void *)0)w+path != ((void *)0)tmp-XXXXXXXXXXfile != ((void *)0) && time != ((void *)0)time != ((void *)0)../fsaccess.ctrustee <= 0x7permission <= 0xFFfsaccess.caccess == 0keyboard.ckeyboard != ((void *)0)/dev/ttynet.csocket() %s: %sretrieving the address of an IPv6 socket from the kernel failed.IPv6 is not supported.IPv6 structures in kernel and user space do not match.socket.c(((ev->bufferlist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((sock) != ((void *)0)) && (((const isc__magic_t *)(sock))->magic == ((('I') << 24 | ('O') << 16 | ('i') << 8 | ('o')))))((*((&sock->lock)))++ == 0 ? 0 : 34) == 0(--(*((&sock->lock))) == 0 ? 0 : 34) == 0addressp != ((void *)0)socketp != ((void *)0) && *socketp == ((void *)0)(((socket) != ((void *)0)) && (((const isc__magic_t *)(socket))->magic == ((('I') << 24 | ('O') << 16 | ('i') << 8 | ('o')))))((*((&socket->lock)))++ == 0 ? 0 : 34) == 0(--(*((&socket->lock))) == 0 ? 0 : 34) == 0fd >= 0 && fd < (int)1024dev != ((void *)0) && *dev != ((void *)0)(sock->send_list).tail == (*dev)(sock->send_list).head == (*dev)(sock->recv_list).tail == (*dev)(sock->recv_list).head == (*dev)socket %p: %ssocket %p %s: %smaxfd <= (int)1024!sock->pending_accept!sock->pending_recvdispatch_recv: event %p -> task %psock->connecting!sock->pending_senddispatch_send: event %p -> task %psock->references == 0!sock->connecting(((sock->recv_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((sock->send_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)(((sock->accept_list).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)!((void *)((sock)->link.prev) != (void *)(-1))(*((&sock->lock)) == 0 ? (*((&sock->lock)) = -1, 0) : 34) == 0(sock->accept_list).tail == (dev)(sock->accept_list).head == (dev)destroyingsock->connect_ev == ((void *)0)sock->fd >= 0 && sock->fd < (int)1024(manager->socklist).tail == (sock)(manager->socklist).head == (sock)ev->ev_type == (((2) << 16) + 256)internal_fdwatch_read: task %p got event %psock->pending_recv == 1sock->references > 0ev->ev_type == (((2) << 16) + 257)internal_fdwatch_write: task %p got event %psock->pending_send == 1internal_accept called, locked socket(((manager) != ((void *)0)) && (((const isc__magic_t *)(manager))->magic == ((('I') << 24 | ('O') << 16 | ('m') << 8 | ('g')))))sock->listenersock->pending_accept == 1acceptfcntlinternal_accept: %s() %s: %sinternal_accept(): accept() failed to return remote addressinternal_accept(): accept() returned peer address family %u (expected %u)%s: too many open file descriptorsaccepted connection, new socket %psocketp != ((void *)0)(((buffer) != ((void *)0)) && (((const isc__magic_t *)(buffer))->magic == (0x42756621U)))iovcount < (8)doio_recv: recvmsg(%d) %d bytes, err %d/%sdropping source port zero packetpacket received correctlyprocessing cmsg %pinterface received on ifindex %uactual_count == 0Uinternal_recv: task %p got event %pinternal_connect: connect(%s) %sskip_count == 0Usendto pktinfo data, ifindex %umsg->msg_controllen <= sock->sendcmsgbufleninternal_send: %s: %sreturnedinternal_send: send() %s 0internal_send: task %p got event %pgetsockname: %s%d/%ssocket_recv: event %p -> task %psock->boundfdwatch-created!sock->listenersock->type == isc_sockettype_tcp || sock->type == isc_sockettype_unixlisten: %s!sock->boundsetsockopt(%d) %sbind: %sboundsockmgr %p: %ssockaddr->type.sa.sa_family == 1strlen(sockaddr->type.sunix.sun_path) < sizeof(path)isc_socket_permunix: chmod(%s, %d): %sisc_socket_permunix: chown(%s, %d, %d): %saddress == ((void *)0)pktinfo structure provided, ifindex %u (set to 0)socket_send: event %p -> task %p(flags & ~(0x00000001|0x00000002)) == 0sock->type == isc_sockettype_udpregion != ((void *)0)buflist != ((void *)0)!(((*buflist).head == ((void *)0)) ? isc_boolean_true : isc_boolean_false)iocount > 0(*buflist).tail == (buffer)(*buflist).head == (buffer)sockets existtype != isc_sockettype_fdwatchisc_socket_create: fcntl%s() %s: %ssetsockopt(%d, SO_BSDCOMPAT) %s: %ssetsockopt(%d, SO_TIMESTAMP) %s: %sNo buffer available to receive IPv6 destinationsetsockopt(%d, IPV6_RECVPKTINFO) %s: %ssetsockopt(%d, SO_RCVBUF, %d) %s: %sisc_socket_cleanunix: stat(%s): %sisc_socket_cleanunix: %s: not a socketisc_socket_cleanunix: unlink(%s): %sisc_socket_cleanunix: socket(%s): %sisc_socket_cleanunix: connect(%s): %sstdtime.cgettimeofday(&tv, ((void *)0)) != -1gettimeofday returned bad tv_usec: correctedtv.tv_usec >= 0strerror.c((*((&isc_strerror_lock)))++ == 0 ? 0 : 34) == 0Unknown error: %u(--(*((&isc_strerror_lock))) == 0 ? 0 : 34) == 0i != ((void *)0)i->nanoseconds < 1000000000t->nanoseconds < 1000000000t1 != ((void *)0) && t2 != ((void *)0)t1->nanoseconds < 1000000000 && t2->nanoseconds < 1000000000t != ((void *)0) && i != ((void *)0) && result != ((void *)0)t->nanoseconds < 1000000000 && i->nanoseconds < 1000000000len > 0%Y-%m-%dT%H:%M:%SZflen < len%a, %d %b %Y %H:%M:%S GMT%d-%b-%Y %X.%03u99-Bad-9999 99:99:99.999msgcat.c(((msgcat) != ((void *)0)) && (((const isc__magic_t *)(msgcat))->magic == ((('M') << 24 | ('C') << 16 | ('a') << 8 | ('t'))))) || msgcat == ((void *)0)set > 0message > 0default_text != ((void *)0)msgcatp != ((void *)0)msgcatp != ((void *)0) && *msgcatp == ((void *)0)bufferlist.cbl != ((void *)0) Hx0U H(  8X0(oooД5\R L nSND>>nSNDx >*܈@  ,v$,4@@< DLT\dlt|     ĉ̉tЉԉ܉(4<DHL9: ::$:,:4:@:H: P: X:PX`hpx9: ::$:,:4:@:H: P: X:`:IN-ADDRARPA IP6ARPA IP6INTlp     (  (L`p(<HP\l|fxh/(@Tx 0@T`lt|$0DTp$4@P`t ,8Hh9: ::$:,:4:@:H:P:X: $`:; ; Internet Root Nameservers ; $TTL 518400 . 518400 IN NS A.ROOT-SERVERS.NET. . 518400 IN NS B.ROOT-SERVERS.NET. . 518400 IN NS C.ROOT-SERVERS.NET. . 518400 IN NS D.ROOT-SERVERS.NET. . 518400 IN NS E.ROOT-SERVERS.NET. . 518400 IN NS F.ROOT-SERVERS.NET. . 518400 IN NS G.ROOT-SERVERS.NET. . 518400 IN NS H.ROOT-SERVERS.NET. . 518400 IN NS I.ROOT-SERVERS.NET. . 518400 IN NS J.ROOT-SERVERS.NET. . 518400 IN NS K.ROOT-SERVERS.NET. . 518400 IN NS L.ROOT-SERVERS.NET. . 518400 IN NS M.ROOT-SERVERS.NET. A.ROOT-SERVERS.NET. 3600000 IN A 198.41.0.4 A.ROOT-SERVERS.NET. 3600000 IN AAAA 2001:503:BA3E::2:30 B.ROOT-SERVERS.NET. 3600000 IN A 192.228.79.201 C.ROOT-SERVERS.NET. 3600000 IN A 192.33.4.12 D.ROOT-SERVERS.NET. 3600000 IN A 128.8.10.90 E.ROOT-SERVERS.NET. 3600000 IN A 192.203.230.10 F.ROOT-SERVERS.NET. 3600000 IN A 192.5.5.241 F.ROOT-SERVERS.NET. 3600000 IN AAAA 2001:500:2F::F G.ROOT-SERVERS.NET. 3600000 IN A 192.112.36.4 H.ROOT-SERVERS.NET. 3600000 IN A 128.63.2.53 H.ROOT-SERVERS.NET. 3600000 IN AAAA 2001:500:1::803F:235 I.ROOT-SERVERS.NET. 3600000 IN A 192.36.148.17 J.ROOT-SERVERS.NET. 3600000 IN A 192.58.128.30 J.ROOT-SERVERS.NET. 3600000 IN AAAA 2001:503:C27::2:30 K.ROOT-SERVERS.NET. 3600000 IN A 193.0.14.129 K.ROOT-SERVERS.NET. 3600000 IN AAAA 2001:7FD::1 L.ROOT-SERVERS.NET. 3600000 IN A 199.7.83.42 M.ROOT-SERVERS.NET. 3600000 IN A 202.12.27.33 M.ROOT-SERVERS.NET. 3600000 IN AAAA 2001:DC3::35 @,3 ,///0<0h000nSND01nSND 1 1nSND1+1nSND01 ;1nSND@1 M1nSNDP1 ]1nSND`1 m1nSNDp1 }1hmac-md5sig-algregint gss-tsig gss microsoftcom hmac-sha1 hmac-sha224 hmac-sha256 hmac-sha384 hmac-sha512 zone_loaddone R(R8RXR|RRRRRSSS$S0S